BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060583.seq (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 2.3 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 4.0 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 4.0 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.0 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 5.3 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 5.3 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.2 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.2 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.2 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.2 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.2 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.2 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 9.2 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 9.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 9.2 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 9.2 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 25.0 bits (52), Expect = 2.3 Identities = 24/106 (22%), Positives = 39/106 (36%) Frame = +1 Query: 325 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 504 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1806 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1864 Query: 505 LRGNKIGKPHTVPCKVTGKCGSVTXRLIPAPRGTXIMSCGQFPKEG 642 + + P T TG S ++ + +++ GQ G Sbjct: 1865 ISSMTV--PATSSVSTTGGSSST---MVSSAVSNSVVATGQAVNNG 1905 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 24.2 bits (50), Expect = 4.0 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +3 Query: 330 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 503 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 24.2 bits (50), Expect = 4.0 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +3 Query: 330 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 503 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 4.0 Identities = 21/82 (25%), Positives = 30/82 (36%) Frame = +1 Query: 325 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 504 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1805 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1863 Query: 505 LRGNKIGKPHTVPCKVTGKCGS 570 + + P T TG S Sbjct: 1864 ISSMTV--PATSSVSTTGGSSS 1883 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 348 VCFCTGMIFRTSSFRDGPRKKSMISNSLIGKETSK 244 VC + RTSSF P +++ +IG +T++ Sbjct: 76 VCCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTE 110 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 397 QQRSYWFGCEVQQGSRHCHSRR 462 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 269 EFEIIDFFLGPSLNDEVLKIMPV 337 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 186 EPTLSGLPCRAHDHGRDXDRVHEDRRGL 103 EP SG +A D G+ +R H+ +GL Sbjct: 315 EPGRSGEKGQAGDRGQVGERGHKGEKGL 342 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 340 LYRHDL*NLIIQGRAEE 290 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.0 bits (47), Expect = 9.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 541 GRCVAFRSCYPV 506 G+CV FR C P+ Sbjct: 39 GKCVLFRECQPL 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,452 Number of Sequences: 2352 Number of extensions: 14541 Number of successful extensions: 37 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -