BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060582.seq (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 3.6 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 4.7 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 6.3 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 22 6.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 6.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 6.3 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 22 6.3 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 6.3 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 8.3 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 8.3 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.3 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.3 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.3 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.3 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -2 Query: 263 LVKKQVNALEFVDFSFANKTAEFGDRNPLFLVF 165 ++ + +++ + V++ T GD P+FL F Sbjct: 352 MLVQDISSPDAVEYGIIGPTTCMGDHKPVFLEF 384 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 402 TVILVWV*SAARKSPL 449 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 623 ASFLRSFFQDWLVVQGTA 676 A+F R Q W+ GTA Sbjct: 344 AAFFRGMMQAWMTALGTA 361 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 221 KNRQTREHLLVSLPIKEFEII 283 KN QTREH L++ + ++I Sbjct: 129 KNGQTREHALLAFTLGVKQLI 149 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 221 KNRQTREHLLVSLPIKEFEII 283 KN QTREH L++ + ++I Sbjct: 56 KNGQTREHALLAFTLGVKQLI 76 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 185 SCHQTRP-SCSRRKNRQTRE 241 S H +R SCSR +NR+ +E Sbjct: 228 SSHYSRERSCSRDRNREYKE 247 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 173 EXVGSCHQTRPSCSRRKNRQTRE 241 + S + SCSR +NR+ RE Sbjct: 225 QHTSSRYSRERSCSRDRNREYRE 247 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 221 KNRQTREHLLVSLPIKEFEII 283 KN QTREH L++ + ++I Sbjct: 72 KNGQTREHALLAFTLGVKQLI 92 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 221 KNRQTREHLLVSLPIKEFEII 283 KN QTREH L++ + ++I Sbjct: 129 KNGQTREHALLAFTLGVKQLI 149 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 217 KEKSTNSRAFTCFFTNQRIRDH*FLPRPV 303 KEK R +C +R + FL RP+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPI 29 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 206 SCSRRKNRQTRE 241 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,365 Number of Sequences: 438 Number of extensions: 3925 Number of successful extensions: 26 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -