BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060580.seq (669 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 30 1.5 01_01_0136 + 1237623-1237820,1238313-1239001,1239978-1240308,124... 28 5.9 >01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 Length = 417 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 138 VSQNTGTCPESSCACPETSCACPETSCA 221 ++++ TCP + C CPE C S A Sbjct: 116 ITEHEKTCPHAPCFCPEPGCGFAAASAA 143 >01_01_0136 + 1237623-1237820,1238313-1239001,1239978-1240308, 1240614-1241351 Length = 651 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 108 CSFCKLY*TCVSQNTGTCPESSCACPETSCACPETSCACP 227 CS +Y V+ + CP + C+CPE C + A P Sbjct: 456 CSSYVVY-AGVADHQRACPCAPCSCPEPGCRFRSSPAALP 494 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,669,483 Number of Sequences: 37544 Number of extensions: 90059 Number of successful extensions: 294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -