BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060579.seq (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 9.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.2 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 146 FYMNLTTFILLGKFQSKNALLQILGRITIKKYHSFNKY 259 +Y + T L G S +Q LGR T + N Y Sbjct: 477 YYRSFTKGELFGSKPSTTTAIQFLGRPTYADRYDANDY 514 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 456 GGRQWLQTI*RLLNKIFVGISKRVNPR 376 G + L TI R L+K+F+ ISK+ + R Sbjct: 2619 GMKPTLVTILRRLDKVFLKISKKSSVR 2645 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 616,614 Number of Sequences: 2352 Number of extensions: 11908 Number of successful extensions: 226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -