BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060577.seq (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.1 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 5.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 408 PPHATLHFEVELINIGDSPPATNVFKEIDADKDKC 512 PP T H++ + + P T V + ID DKC Sbjct: 1176 PPSTTNHWQTKTTTSTTTRPTTTVSQLID---DKC 1207 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.8 bits (44), Expect = 5.4 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 575 FTTXRRE-PSASSNSRSLLRGRAFVLIGVDFLEHVCGRWRVTDVD 444 F + R+ P+ S+ S ++ +DFL HV DVD Sbjct: 116 FASLRKSIPTMPSDKLSKIQTLKLAARYIDFLYHVLSNENALDVD 160 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 118 GPEVTELKTEVVSVPEGCT 174 GP++TEL+ E + + T Sbjct: 282 GPQITELEPETIESQDAIT 300 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 118 GPEVTELKTEVVSVPEGCT 174 GP++TEL+ E + + T Sbjct: 515 GPQITELEPETIESQDAIT 533 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 118 GPEVTELKTEVVSVPEGCT 174 GP++TEL+ E + + T Sbjct: 515 GPQITELEPETIESQDAIT 533 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 463 GESPMLINSTSKCNVAW 413 G +PM+ NST + V W Sbjct: 339 GITPMIWNSTRRLFVVW 355 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,293 Number of Sequences: 336 Number of extensions: 3160 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -