BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060575.seq (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 7.7 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 7.7 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 7.7 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 87 SRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 ++ TPRSS A L P S+ ++A Sbjct: 149 NKVSTPRSSPAETASSLSPQSVASTASSA 177 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/33 (21%), Positives = 20/33 (60%) Frame = -2 Query: 265 ELFDSAFGHLSIGKLVLYHIMEVGLLVMLCILI 167 ++F+S + H + +Y+ + +GLL++ + + Sbjct: 303 QVFESFYLHKATTLETVYYFISLGLLILRLVSV 335 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 87 SRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 ++ TPRSS A L P S+ ++A Sbjct: 140 NKVSTPRSSPAETASSLSPQSVASTASSA 168 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,603 Number of Sequences: 336 Number of extensions: 2222 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -