BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060575.seq (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1381| Best HMM Match : TP2 (HMM E-Value=5.2) 39 0.005 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 38 0.011 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 37 0.019 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 37 0.019 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 36 0.034 SB_636| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.044 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.044 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.044 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.059 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 35 0.059 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 35 0.059 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) 35 0.059 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 35 0.059 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 35 0.059 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 35 0.059 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 35 0.059 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 35 0.078 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 35 0.078 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 35 0.078 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 35 0.078 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 35 0.078 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 35 0.078 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 35 0.078 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 34 0.10 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 34 0.10 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 34 0.10 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 34 0.10 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 34 0.10 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 34 0.10 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 34 0.10 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 34 0.14 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 34 0.14 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 34 0.14 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 34 0.14 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_4841| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 33 0.18 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 33 0.18 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 33 0.18 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 33 0.18 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.18 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 33 0.18 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 33 0.18 SB_41525| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38022| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35116| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 33 0.18 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 33 0.18 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 33 0.18 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 33 0.18 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 33 0.18 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 33 0.18 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 33 0.18 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 33 0.18 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 33 0.18 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 33 0.18 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_16406| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 33 0.18 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) 33 0.18 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 33 0.18 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 33 0.18 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 33 0.18 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 33 0.18 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_2493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 33 0.18 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 33 0.18 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58381| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.18 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 33 0.18 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_53203| Best HMM Match : UCR_TM (HMM E-Value=5.1) 33 0.18 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 33 0.18 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 33 0.18 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 33 0.18 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 33 0.18 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 33 0.18 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 33 0.18 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46741| Best HMM Match : UCR_TM (HMM E-Value=5.1) 33 0.18 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 33 0.18 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 33 0.18 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_45316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 33 0.18 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40405| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 33 0.18 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 33 0.18 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -3 Query: 87 SRTDTPRSSGT-PRAEFLQPGGSTSSRAAA 1 S TPR+ G R EFLQPGGSTSSRAAA Sbjct: 51 SPKSTPRNCGNGQRIEFLQPGGSTSSRAAA 80 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 75 TPRSSGTPRAEFLQPGGSTSSRAAA 1 TP++ T EFLQPGGSTSSRAAA Sbjct: 91 TPQNQHTKTIEFLQPGGSTSSRAAA 115 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 +S+ +P EFLQPGGSTSSRAAA Sbjct: 18 KSASSPMIEFLQPGGSTSSRAAA 40 >SB_1381| Best HMM Match : TP2 (HMM E-Value=5.2) Length = 428 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/35 (57%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -3 Query: 102 R*RRASRTDTPRSSGTP-RAEFLQPGGSTSSRAAA 1 R ++ TD+P +G EFLQPGGSTSSRAAA Sbjct: 126 RKKKQDTTDSPPKAGQEMEIEFLQPGGSTSSRAAA 160 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = -1 Query: 98 EGELQERILQGHLE---LLVPNSXSPGDPLVLERP 3 EG ++E+ LQG++ L V NS SPGDPLVLERP Sbjct: 22 EGYIREK-LQGYIREFVLRVSNSCSPGDPLVLERP 55 >SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 Query: 90 ASRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 +S T +P P EFLQPGGSTSSRAAA Sbjct: 5 SSETPSPSFLRDPIIEFLQPGGSTSSRAAA 34 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 PR EFLQPGGSTSSRAAA Sbjct: 40 PRIEFLQPGGSTSSRAAA 57 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -3 Query: 75 TPRSSGTPRAEFLQPGGSTSSRAAA 1 T R T EFLQPGGSTSSRAAA Sbjct: 88 TVRKGSTTHIEFLQPGGSTSSRAAA 112 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 37.9 bits (84), Expect = 0.008 Identities = 24/71 (33%), Positives = 37/71 (52%) Frame = -1 Query: 215 VPYNGGRIIGNALYPNIISLLLSEQVGELLDNFTFVFSVEGELQERILQGHLELLVPNSX 36 VP G + G+A P +S+ + + E+ T + + + Q + + +V NS Sbjct: 26 VPRTTGSVTGSAPEPTALSI---DAIVEMHVYKTILRARKANAQVQKHHRGVNTIVSNSC 82 Query: 35 SPGDPLVLERP 3 SPGDPLVLERP Sbjct: 83 SPGDPLVLERP 93 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 74 LQGHLELLVPNSXSPGDPLVLERP 3 LQG +L NS SPGDPLVLERP Sbjct: 30 LQGEHRVLTSNSCSPGDPLVLERP 53 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 SS P EFLQPGGSTSSRAAA Sbjct: 105 SSRGPNIEFLQPGGSTSSRAAA 126 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = -1 Query: 110 VFSVEGELQERILQGHLELLVPNSXSPGDPLVLERP 3 +FSV G ++G L NS SPGDPLVLERP Sbjct: 47 IFSVFGFSGIIFMEGRFPKLSSNSCSPGDPLVLERP 82 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G P EFLQPGGSTSSRAAA Sbjct: 31 GYPNIEFLQPGGSTSSRAAA 50 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 S GT EFLQPGGSTSSRAAA Sbjct: 15 SKGTYLIEFLQPGGSTSSRAAA 36 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 77 ILQGHLELLVPNSXSPGDPLVLERP 3 ++ L +LV NS SPGDPLVLERP Sbjct: 1 MIHNTLRILVSNSCSPGDPLVLERP 25 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -3 Query: 63 SGTPRAEFLQPGGSTSSRAAA 1 +G R EFLQPGGSTSSRAAA Sbjct: 6 TGESRIEFLQPGGSTSSRAAA 26 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 TP EFLQPGGSTSSRAAA Sbjct: 23 TPPIEFLQPGGSTSSRAAA 41 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -3 Query: 63 SGTPRAEFLQPGGSTSSRAAA 1 SG + EFLQPGGSTSSRAAA Sbjct: 17 SGRSKIEFLQPGGSTSSRAAA 37 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 128 LDNFTFVFSVE--GELQERILQGHLELLVPNSXSPGDPLVLERP 3 ++NF V G E + Q H L+ NS SPGDPLVLERP Sbjct: 44 VENFLLALFVNHVGRSCEVVYQ-HFPCLISNSCSPGDPLVLERP 86 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 72 PRSSGTPRAEFLQPGGSTSSRAAA 1 P +GT EFLQPGGSTSSRAAA Sbjct: 18 PFLTGTRLIEFLQPGGSTSSRAAA 41 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 R S R EFLQPGGSTSSRAAA Sbjct: 13 RFSSDHRIEFLQPGGSTSSRAAA 35 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P+ EFLQPGGSTSSRAAA Sbjct: 50 PKIEFLQPGGSTSSRAAA 67 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P+ EFLQPGGSTSSRAAA Sbjct: 6 PKIEFLQPGGSTSSRAAA 23 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -1 Query: 86 QERILQGHLELLVPNSXSPGDPLVLERP 3 ++R+L E + NS SPGDPLVLERP Sbjct: 34 KKRVLSAVFETVPSNSCSPGDPLVLERP 61 >SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -3 Query: 93 RASRTDTPR--SSGTPRAEFLQPGGSTSSRAAA 1 R +TD+ R P EFLQPGGSTSSRAAA Sbjct: 56 RLHQTDSARCIDHTRPTIEFLQPGGSTSSRAAA 88 >SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 81 TDTPRSSGTPRAEFLQPGGSTSSRAAA 1 T R+ R EFLQPGGSTSSRAAA Sbjct: 34 TGQTRTQSLLRIEFLQPGGSTSSRAAA 60 >SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.7 bits (81), Expect = 0.019 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = -3 Query: 90 ASRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 A RT P+ EFLQPGGSTSSRAAA Sbjct: 11 AYRTLKPKMHDQIHIEFLQPGGSTSSRAAA 40 >SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) Length = 175 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 72 PRSSGTPRAEFLQPGGSTSSRAAA 1 P+S EFLQPGGSTSSRAAA Sbjct: 44 PKSKAKGSIEFLQPGGSTSSRAAA 67 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G R EFLQPGGSTSSRAAA Sbjct: 47 GFSRIEFLQPGGSTSSRAAA 66 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 +P EFLQPGGSTSSRAAA Sbjct: 8 SPNIEFLQPGGSTSSRAAA 26 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 36.3 bits (80), Expect = 0.025 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -3 Query: 75 TPRSSGTPRAEFLQPGGSTSSRAAA 1 T +S +P EFLQPGGST SRA+A Sbjct: 78 TRKSMSSPNIEFLQPGGSTRSRASA 102 >SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 72 PRSSGTPRAEFLQPGGSTSSRAAA 1 P G + EFLQPGGSTSSRAAA Sbjct: 25 PPPLGRQKIEFLQPGGSTSSRAAA 48 >SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 +S G EFLQPGGSTSSRAAA Sbjct: 11 QSGGNKDIEFLQPGGSTSSRAAA 33 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = -1 Query: 83 ERILQGHLELLVPNSXSPGDPLVLERP 3 + ++ ++ L+ NS SPGDPLVLERP Sbjct: 6 DTLISANIVFLISNSCSPGDPLVLERP 32 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 L+LL NS SPGDPLVLERP Sbjct: 22 LQLLPSNSCSPGDPLVLERP 41 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 LLV NS SPGDPLVLERP Sbjct: 16 LLVSNSCSPGDPLVLERP 33 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.9 bits (79), Expect = 0.034 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -3 Query: 84 RTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 + D G+ EFLQPGGSTSSRAAA Sbjct: 30 KLDPESGRGSQPIEFLQPGGSTSSRAAA 57 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.9 bits (79), Expect = 0.034 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +2 Query: 2 AAALELVDPPGXRNSARGVPDDLGVSVLEAR 94 AAALELVDPPG RNS + D G +V+E R Sbjct: 10 AAALELVDPPGCRNSIEVIRDAAG-NVVELR 39 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 L LL NS SPGDPLVLERP Sbjct: 2 LNLLASNSCSPGDPLVLERP 21 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 35.9 bits (79), Expect = 0.034 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = -3 Query: 111 CF*R*RRASRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 C R R S +TP + EFLQPGGSTSSRAAA Sbjct: 9 CILRVSRCSLKETPELY---QIEFLQPGGSTSSRAAA 42 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 28 PEIEFLQPGGSTSSRAAA 45 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.034 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -3 Query: 63 SGTPRAEFLQPGGSTSSRAAA 1 S +P EFLQPGGSTSSRAAA Sbjct: 4 SVSPYIEFLQPGGSTSSRAAA 24 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 +E+L NS SPGDPLVLERP Sbjct: 14 MEVLASNSCSPGDPLVLERP 33 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 3 PEIEFLQPGGSTSSRAAA 20 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 55 PNIEFLQPGGSTSSRAAA 72 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 26 PEIEFLQPGGSTSSRAAA 43 >SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) Length = 207 Score = 35.9 bits (79), Expect = 0.034 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 RS + EFLQPGGSTSSRAAA Sbjct: 78 RSPAARQIEFLQPGGSTSSRAAA 100 >SB_636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.034 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 GT EFLQPGGSTSSRAAA Sbjct: 6 GTLTIEFLQPGGSTSSRAAA 25 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 35.5 bits (78), Expect = 0.044 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 179 LYPNIISLLLSEQVGELLDNFTFV-FSVEGELQERILQGHLELLVPNSXSPGDPLVLERP 3 LY + + L+ + +LLD+F + +V ++ G + NS SPGDPLVLERP Sbjct: 139 LYRLLENGALTSEDDDLLDDFLQIDVTVSVTNSLTVIAGTTTIPPSNSCSPGDPLVLERP 198 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 35.5 bits (78), Expect = 0.044 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -3 Query: 81 TDTPRSSGTP-RAEFLQPGGSTSSRAAA 1 TDT S+ R EFLQPGGSTSSRAAA Sbjct: 5 TDTLISANIVLRIEFLQPGGSTSSRAAA 32 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.044 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 23 PSIEFLQPGGSTSSRAAA 40 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 35.5 bits (78), Expect = 0.044 Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 1/20 (5%) Frame = -3 Query: 57 TPR-AEFLQPGGSTSSRAAA 1 TPR EFLQPGGSTSSRAAA Sbjct: 427 TPRHIEFLQPGGSTSSRAAA 446 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 35.5 bits (78), Expect = 0.044 Identities = 18/30 (60%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -1 Query: 86 QERILQGH--LELLVPNSXSPGDPLVLERP 3 + R +Q H LE NS SPGDPLVLERP Sbjct: 468 RRRYIQAHPILEAGASNSCSPGDPLVLERP 497 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 35.5 bits (78), Expect = 0.044 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 146 PAIEFLQPGGSTSSRAAA 163 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.5 bits (78), Expect = 0.044 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -3 Query: 78 DTPRSSGTPRA-EFLQPGGSTSSRAAA 1 D R+ PR EFLQPGGSTSSRAAA Sbjct: 30 DLYRTRRDPRTIEFLQPGGSTSSRAAA 56 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.044 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 + S P EFLQPGGSTSSRAAA Sbjct: 7 KPSMCPPIEFLQPGGSTSSRAAA 29 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.5 bits (78), Expect = 0.044 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 +SG EFLQPGGSTSSRAAA Sbjct: 20 TSGKRYIEFLQPGGSTSSRAAA 41 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 35.5 bits (78), Expect = 0.044 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -3 Query: 78 DTPRSSGTPRAEFLQPGGSTSSRAAA 1 D P + EFLQPGGSTSSRAAA Sbjct: 41 DLPNNVRLSSIEFLQPGGSTSSRAAA 66 >SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.044 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T + EFLQPGGSTSSRAAA Sbjct: 7 TEKIEFLQPGGSTSSRAAA 25 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.044 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 13 PTIEFLQPGGSTSSRAAA 30 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.044 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 74 LQGHLELLVPNSXSPGDPLVLERP 3 L+G L NS SPGDPLVLERP Sbjct: 7 LEGSRRLQTSNSCSPGDPLVLERP 30 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.044 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -1 Query: 128 LDNFTFVFSVEGELQE--RILQGHLELLVPNSXSPGDPLVLERP 3 +D+FTF+ S + +I L L+ NS SPGDPLVLERP Sbjct: 1 MDDFTFLDSKKKAKSRFAKIPFTTLPLVPSNSCSPGDPLVLERP 44 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 65 HLELLVPNSXSPGDPLVLERP 3 +L +V NS SPGDPLVLERP Sbjct: 343 YLHSIVSNSCSPGDPLVLERP 363 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.1 bits (77), Expect = 0.059 Identities = 18/27 (66%), Positives = 20/27 (74%), Gaps = 3/27 (11%) Frame = -1 Query: 74 LQGHLEL---LVPNSXSPGDPLVLERP 3 L G +EL L+ NS SPGDPLVLERP Sbjct: 7 LYGFVELISFLISNSCSPGDPLVLERP 33 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 113 PGIEFLQPGGSTSSRAAA 130 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.1 bits (77), Expect = 0.059 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 S G P EFLQPGGSTSSRAAA Sbjct: 13 SEGCP-IEFLQPGGSTSSRAAA 33 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 5 RIEFLQPGGSTSSRAAA 21 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 40 PDIEFLQPGGSTSSRAAA 57 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 139 RIEFLQPGGSTSSRAAA 155 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 3 RIEFLQPGGSTSSRAAA 19 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.1 bits (77), Expect = 0.059 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -1 Query: 83 ERILQGHLELLVPNSXSPGDPLVLERP 3 + ++ ++++ + NS SPGDPLVLERP Sbjct: 6 DTLISANIDIPLSNSCSPGDPLVLERP 32 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 16 RIEFLQPGGSTSSRAAA 32 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 228 RIEFLQPGGSTSSRAAA 244 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.1 bits (77), Expect = 0.059 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -3 Query: 75 TPRSSGTPRAEFLQPGGSTSSRAAA 1 TP EFLQPGGSTSSRAAA Sbjct: 25 TPTKYNPLHIEFLQPGGSTSSRAAA 49 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 2 RIEFLQPGGSTSSRAAA 18 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 3 RIEFLQPGGSTSSRAAA 19 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.1 bits (77), Expect = 0.059 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -3 Query: 81 TDTPRSSGTPRAEFLQPGGSTSSRAAA 1 T R G EFLQPGGSTSSRAAA Sbjct: 22 TRKKREHGPYYIEFLQPGGSTSSRAAA 48 >SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) Length = 91 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 2 PYIEFLQPGGSTSSRAAA 19 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 65 HLELLVPNSXSPGDPLVLERP 3 H +L NS SPGDPLVLERP Sbjct: 61 HTPILPSNSCSPGDPLVLERP 81 >SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) Length = 141 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 17 RIEFLQPGGSTSSRAAA 33 >SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 7 RIEFLQPGGSTSSRAAA 23 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 +LV NS SPGDPLVLERP Sbjct: 4 MLVSNSCSPGDPLVLERP 21 >SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 24 RIEFLQPGGSTSSRAAA 40 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 +LV NS SPGDPLVLERP Sbjct: 1 MLVSNSCSPGDPLVLERP 18 >SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 78 RIEFLQPGGSTSSRAAA 94 >SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 35.1 bits (77), Expect = 0.059 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 SS EFLQPGGSTSSRAAA Sbjct: 98 SSDKSNIEFLQPGGSTSSRAAA 119 >SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 19 RIEFLQPGGSTSSRAAA 35 >SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 64 RIEFLQPGGSTSSRAAA 80 >SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 19 PDIEFLQPGGSTSSRAAA 36 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 59 ELLVPNSXSPGDPLVLERP 3 EL + NS SPGDPLVLERP Sbjct: 168 ELFLSNSCSPGDPLVLERP 186 >SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 26 RIEFLQPGGSTSSRAAA 42 >SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 12 RIEFLQPGGSTSSRAAA 28 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 +LV NS SPGDPLVLERP Sbjct: 25 MLVSNSCSPGDPLVLERP 42 >SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 15 RIEFLQPGGSTSSRAAA 31 >SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 4 RIEFLQPGGSTSSRAAA 20 >SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 68 RIEFLQPGGSTSSRAAA 84 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 25 RIEFLQPGGSTSSRAAA 41 >SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 3 RIEFLQPGGSTSSRAAA 19 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 35.1 bits (77), Expect = 0.059 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -3 Query: 84 RTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 R R+S EFLQPGGSTSSRAAA Sbjct: 56 RRKNRRTSAGISIEFLQPGGSTSSRAAA 83 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +2 Query: 2 AAALELVDPPGXRNSARGVP 61 AAALELVDPPG RNS G P Sbjct: 97 AAALELVDPPGCRNSITGGP 116 >SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 R EFLQPGGSTSSRAAA Sbjct: 17 RIEFLQPGGSTSSRAAA 33 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.1 bits (77), Expect = 0.059 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 32 PDIEFLQPGGSTSSRAAA 49 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 32 GLSNIEFLQPGGSTSSRAAA 51 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 55 TTNIEFLQPGGSTSSRAAA 73 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 75 PCIEFLQPGGSTSSRAAA 92 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 22 PCIEFLQPGGSTSSRAAA 39 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 LE ++ NS SPGDPLVLERP Sbjct: 52 LEPILSNSCSPGDPLVLERP 71 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 34.7 bits (76), Expect = 0.078 Identities = 21/46 (45%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 1 GGRSRTSGSPGLXEF-GTXXXXXXXXXXXXXXXXTLKTNVKLSRSS 135 GGRSRTSGSPGL EF T TL K+S+SS Sbjct: 9 GGRSRTSGSPGLQEFDATWAAGHRMVEQGANSSDTLTATDKISKSS 54 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 1 GGRSRTSGSPGLXEFGT 51 GGRSRTSGSPGL EF T Sbjct: 9 GGRSRTSGSPGLQEFDT 25 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 1 GGRSRTSGSPGLXEFGT 51 GGRSRTSGSPGL EF T Sbjct: 52 GGRSRTSGSPGLQEFDT 68 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 1 GGRSRTSGSPGLXEFGT 51 GGRSRTSGSPGL EF T Sbjct: 9 GGRSRTSGSPGLQEFDT 25 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 20 PIIEFLQPGGSTSSRAAA 37 >SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 13 GVSMIEFLQPGGSTSSRAAA 32 >SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.7 bits (76), Expect = 0.078 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 81 TDTPRSSGTPRAEFLQPGGSTSSRAAA 1 T R+ EFLQPGGSTSSRAAA Sbjct: 2 TGVSRAKDVMLIEFLQPGGSTSSRAAA 28 >SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.078 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 S+G EFLQPGGSTSSRAAA Sbjct: 2 STGPIIIEFLQPGGSTSSRAAA 23 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 34.7 bits (76), Expect = 0.078 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 1 GGRSRTSGSPGLXEFGT 51 GGRSRTSGSPGL EF T Sbjct: 9 GGRSRTSGSPGLQEFDT 25 >SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 54 PRAEFLQPGGSTSSRAAA 1 P EFLQPGGSTSSRAAA Sbjct: 15 PWIEFLQPGGSTSSRAAA 32 >SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect = 0.078 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = -3 Query: 96 RRASRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 R R T + EFLQPGGSTSSRAAA Sbjct: 8 RHLGRHFTGHAKNDALIEFLQPGGSTSSRAAA 39 >SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) Length = 187 Score = 34.7 bits (76), Expect = 0.078 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 87 SRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 S T PR EFLQPGGSTSSRAAA Sbjct: 51 SGTSGPRKKLFFCIEFLQPGGSTSSRAAA 79 >SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 S+ + EFLQPGGSTSSRAAA Sbjct: 48 SASGAKIEFLQPGGSTSSRAAA 69 >SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 22 GVSMIEFLQPGGSTSSRAAA 41 >SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 13 GPKHIEFLQPGGSTSSRAAA 32 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -3 Query: 78 DTPRSSGTPRAEFLQPGGSTSSRAAA 1 D + + + EFLQPGGSTSSRAAA Sbjct: 20 DPAAKTRSAKIEFLQPGGSTSSRAAA 45 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.7 bits (76), Expect = 0.078 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 L++ NS SPGDPLVLERP Sbjct: 25 LIISNSCSPGDPLVLERP 42 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 74 LQGHLELLVPNSXSPGDPLVLERP 3 L H L NS SPGDPLVLERP Sbjct: 4 LMAHESGLTSNSCSPGDPLVLERP 27 >SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.7 bits (76), Expect = 0.078 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -3 Query: 87 SRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 +RT T +S+ EFLQPGGSTSSRAAA Sbjct: 6 ARTQTGQSATL--IEFLQPGGSTSSRAAA 32 >SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) Length = 247 Score = 34.7 bits (76), Expect = 0.078 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G+ EFLQPGGSTSSRAAA Sbjct: 120 GSALIEFLQPGGSTSSRAAA 139 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 LV NS SPGDPLVLERP Sbjct: 24 LVSNSCSPGDPLVLERP 40 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -3 Query: 102 R*RRASRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 R +R ++P + G EFLQPGGSTSSRAAA Sbjct: 21 RSQRPRIRESPSTLGQ-NIEFLQPGGSTSSRAAA 53 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 23 TQMIEFLQPGGSTSSRAAA 41 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 L V NS SPGDPLVLERP Sbjct: 8 LFVSNSCSPGDPLVLERP 25 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = -1 Query: 125 DNFTFVFSVEGELQERILQGHLELLVPNSXSPGDPLVLERP 3 D+ T + + G E+ +E ++ NS SPGDPLVLERP Sbjct: 69 DDSTIIPTYRGRQDEK-KHVVIEWVLSNSCSPGDPLVLERP 108 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 LV NS SPGDPLVLERP Sbjct: 3 LVSNSCSPGDPLVLERP 19 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 6 GEKTIEFLQPGGSTSSRAAA 25 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 2 AAALELVDPPGXRNSARGV 58 AAALELVDPPG RNS R V Sbjct: 10 AAALELVDPPGCRNSIRTV 28 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 R+S + EFLQPGGSTSSRAAA Sbjct: 9 RASESIFIEFLQPGGSTSSRAAA 31 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/21 (80%), Positives = 17/21 (80%), Gaps = 2/21 (9%) Frame = -1 Query: 59 ELLVP--NSXSPGDPLVLERP 3 ELL P NS SPGDPLVLERP Sbjct: 16 ELLAPTSNSCSPGDPLVLERP 36 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.10 Identities = 20/30 (66%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = -3 Query: 81 TDTPRSSGTPRA---EFLQPGGSTSSRAAA 1 TDT S+ R EFLQPGGSTSSRAAA Sbjct: 5 TDTLISANIKRRCPIEFLQPGGSTSSRAAA 34 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T + EFLQPGGSTSSRAAA Sbjct: 3 TLQIEFLQPGGSTSSRAAA 21 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 2 TNNIEFLQPGGSTSSRAAA 20 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.3 bits (75), Expect = 0.10 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 59 ELLVPNSXSPGDPLVLERP 3 E+ + NS SPGDPLVLERP Sbjct: 48 EIKISNSCSPGDPLVLERP 66 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 LL NS SPGDPLVLERP Sbjct: 77 LLTSNSCSPGDPLVLERP 94 >SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 75 TPRSSGTPRAEFLQPGGSTSSRAAA 1 TP S T EFLQPGGSTSSRAAA Sbjct: 5 TPSSKLT-LIEFLQPGGSTSSRAAA 28 >SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 SS EFLQPGGSTSSRAAA Sbjct: 62 SSSLLSIEFLQPGGSTSSRAAA 83 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 14 TVNIEFLQPGGSTSSRAAA 32 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.10 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -1 Query: 74 LQGHLELLVPNSXSPGDPLVLERP 3 + G + + NS SPGDPLVLERP Sbjct: 13 ITGEFQWQISNSCSPGDPLVLERP 36 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -3 Query: 75 TPRSSGTPRAEFLQPGGSTSSRAAA 1 T + T EFLQPGGSTSSRAAA Sbjct: 4 TAVDTSTACIEFLQPGGSTSSRAAA 28 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -3 Query: 69 RSSGTPRAEFLQPGGSTSSRAAA 1 RS EFLQPGGSTSSRAAA Sbjct: 27 RSKKHKSIEFLQPGGSTSSRAAA 49 >SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/21 (80%), Positives = 19/21 (90%), Gaps = 2/21 (9%) Frame = -3 Query: 57 TPRA--EFLQPGGSTSSRAAA 1 TP++ EFLQPGGSTSSRAAA Sbjct: 48 TPKSTIEFLQPGGSTSSRAAA 68 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -3 Query: 63 SGTPRAEFLQPGGSTSSRAAA 1 S TP EFLQPGGSTSSRAAA Sbjct: 19 SHTP-IEFLQPGGSTSSRAAA 38 >SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -3 Query: 63 SGTPRAEFLQPGGSTSSRAAA 1 S + + EFLQPGGSTSSRAAA Sbjct: 22 SSSLQIEFLQPGGSTSSRAAA 42 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 71 QGHLELLVPNSXSPGDPLVLERP 3 QG +L NS SPGDPLVLERP Sbjct: 29 QGLRKLCESNSCSPGDPLVLERP 51 >SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -3 Query: 87 SRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 +R P+ EFLQPGGSTSSRAAA Sbjct: 12 NRCRLPKLDALRWIEFLQPGGSTSSRAAA 40 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 LV NS SPGDPLVLERP Sbjct: 26 LVSNSCSPGDPLVLERP 42 >SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -3 Query: 72 PRSSGTPRAEFLQPGGSTSSRAAA 1 P T EFLQPGGSTSSRAAA Sbjct: 5 PGWQSTKIIEFLQPGGSTSSRAAA 28 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 65 HLELLVPNSXSPGDPLVLERP 3 H E NS SPGDPLVLERP Sbjct: 14 HTERRASNSCSPGDPLVLERP 34 >SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) Length = 212 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 86 TTTIEFLQPGGSTSSRAAA 104 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 LL NS SPGDPLVLERP Sbjct: 87 LLTSNSCSPGDPLVLERP 104 >SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) Length = 670 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 225 TKTIEFLQPGGSTSSRAAA 243 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 538 TTTIEFLQPGGSTSSRAAA 556 >SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 45 TGNIEFLQPGGSTSSRAAA 63 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 ++ ++ NS SPGDPLVLERP Sbjct: 1 MQTIISNSCSPGDPLVLERP 20 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -1 Query: 89 LQERILQG-HLELLVPNSXSPGDPLVLERP 3 L +R+++ L+ L NS SPGDPLVLERP Sbjct: 2 LSKRVVKWIDLKSLTSNSCSPGDPLVLERP 31 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 65 HLELLVPNSXSPGDPLVLERP 3 H LL NS SPGDPLVLERP Sbjct: 18 HHFLLPSNSCSPGDPLVLERP 38 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 34.3 bits (75), Expect = 0.10 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -3 Query: 93 RASRTDTPRSSGTPRAEFLQPGGSTSSRAAA 1 R SR P S T EFLQPGGSTSSRAAA Sbjct: 46 RFSRAVFP--SLTDLIEFLQPGGSTSSRAAA 74 >SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -3 Query: 72 PRSSGTPRAEFLQPGGSTSSRAAA 1 PR G EFLQPGGSTSSRAAA Sbjct: 17 PRCEGI-YIEFLQPGGSTSSRAAA 39 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 34.3 bits (75), Expect = 0.10 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 + L+ NS SPGDPLVLERP Sbjct: 142 INLITSNSCSPGDPLVLERP 161 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 34.3 bits (75), Expect = 0.10 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 92 ELQERILQGHLELLVPNSXSPGDPLVLERP 3 E+ I+ ++ NS SPGDPLVLERP Sbjct: 55 EVVHHIISAETMVIESNSCSPGDPLVLERP 84 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 71 QGHLELLVPNSXSPGDPLVLERP 3 Q + L + NS SPGDPLVLERP Sbjct: 94 QTNKSLKISNSCSPGDPLVLERP 116 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 40 KIEFLQPGGSTSSRAAA 56 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 93 KIEFLQPGGSTSSRAAA 109 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 69 KIEFLQPGGSTSSRAAA 85 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 44 KIEFLQPGGSTSSRAAA 60 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 29 KIEFLQPGGSTSSRAAA 45 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 80 KIEFLQPGGSTSSRAAA 96 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 37 LISNSCSPGDPLVLERP 53 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 25 KIEFLQPGGSTSSRAAA 41 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -3 Query: 84 RTDTPRSSGTPRA--EFLQPGGSTSSRAAA 1 R+ + + RA EFLQPGGSTSSRAAA Sbjct: 32 RSQRSKQAAVRRAQIEFLQPGGSTSSRAAA 61 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/28 (67%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -3 Query: 81 TDTPRSSGTPRA-EFLQPGGSTSSRAAA 1 TDT S+ + EFLQPGGSTSSRAAA Sbjct: 5 TDTLISANIRSSIEFLQPGGSTSSRAAA 32 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 51 GQKLIEFLQPGGSTSSRAAA 70 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -1 Query: 80 RILQGHLEL--LVPNSXSPGDPLVLERP 3 R+LQG + NS SPGDPLVLERP Sbjct: 467 RLLQGEIASGQTTSNSCSPGDPLVLERP 494 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 7 TYEIEFLQPGGSTSSRAAA 25 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 9 KIEFLQPGGSTSSRAAA 25 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 8 LISNSCSPGDPLVLERP 24 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 17 KIEFLQPGGSTSSRAAA 33 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 + L V NS SPGDPLVLERP Sbjct: 1 MSLHVSNSCSPGDPLVLERP 20 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 +++ NS SPGDPLVLERP Sbjct: 13 IIISNSCSPGDPLVLERP 30 >SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 50 KIEFLQPGGSTSSRAAA 66 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 L V NS SPGDPLVLERP Sbjct: 2 LYVSNSCSPGDPLVLERP 19 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -1 Query: 95 GELQERILQGHLELLVPNSXSPGDPLVLERP 3 G ++E+ LQG++ NS SPGDPLVLERP Sbjct: 7 GYIREK-LQGYIR--ESNSCSPGDPLVLERP 34 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 24 LISNSCSPGDPLVLERP 40 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 56 LLVPNSXSPGDPLVLERP 3 +L+ NS SPGDPLVLERP Sbjct: 5 ILLSNSCSPGDPLVLERP 22 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 2 AAALELVDPPGXRNSARG 55 AAALELVDPPG RNS G Sbjct: 10 AAALELVDPPGCRNSIEG 27 >SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 49 KIEFLQPGGSTSSRAAA 65 >SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G EFLQPGGSTSSRAAA Sbjct: 7 GKSGLEFLQPGGSTSSRAAA 26 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 65 HLELLVPNSXSPGDPLVLERP 3 HL+ NS SPGDPLVLERP Sbjct: 1 HLKKRSSNSCSPGDPLVLERP 21 >SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 16 KIEFLQPGGSTSSRAAA 32 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 40 LISNSCSPGDPLVLERP 56 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 3 KIEFLQPGGSTSSRAAA 19 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -1 Query: 80 RILQGHLELLVPNSXSPGDPLVLERP 3 R+ +G ++ V NS SPGDPLVLERP Sbjct: 24 RVKEG--KIAVSNSCSPGDPLVLERP 47 >SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 66 SSGTPRAEFLQPGGSTSSRAAA 1 S T EFLQPGGSTSSRAAA Sbjct: 5 SPTTLMIEFLQPGGSTSSRAAA 26 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 34 LISNSCSPGDPLVLERP 50 >SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 9 TEDIEFLQPGGSTSSRAAA 27 >SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 57 TPRAEFLQPGGSTSSRAAA 1 T EFLQPGGSTSSRAAA Sbjct: 195 TSGIEFLQPGGSTSSRAAA 213 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 21 LISNSCSPGDPLVLERP 37 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 59 ELLVPNSXSPGDPLVLERP 3 E +V NS SPGDPLVLERP Sbjct: 4 EGIVSNSCSPGDPLVLERP 22 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 ++ +V NS SPGDPLVLERP Sbjct: 24 IQKVVSNSCSPGDPLVLERP 43 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 33 LISNSCSPGDPLVLERP 49 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -1 Query: 89 LQERILQGHLELLV-PNSXSPGDPLVLERP 3 L + + + LE +V NS SPGDPLVLERP Sbjct: 253 LGDEVFREELEEIVGSNSCSPGDPLVLERP 282 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 92 ELQERILQGHLELLVPNSXSPGDPLVLERP 3 + E I++ NS SPGDPLVLERP Sbjct: 15 QYSEHIIKSRCSCQSSNSCSPGDPLVLERP 44 >SB_4841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 51 RAEFLQPGGSTSSRAAA 1 + EFLQPGGSTSSRAAA Sbjct: 3 KIEFLQPGGSTSSRAAA 19 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 53 LVPNSXSPGDPLVLERP 3 L+ NS SPGDPLVLERP Sbjct: 31 LISNSCSPGDPLVLERP 47 >SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 60 GTPRAEFLQPGGSTSSRAAA 1 G+ EFLQPGGSTSSRAAA Sbjct: 7 GSLLIEFLQPGGSTSSRAAA 26 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -1 Query: 101 VEGELQERILQG-HLELLVPNSXSPGDPLVLERP 3 +EG +++G + + + NS SPGDPLVLERP Sbjct: 573 IEGWYPRVVIEGWYPRVGISNSCSPGDPLVLERP 606 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 83 ERILQGHLELLVPNSXSPGDPLVLERP 3 + ++ ++ + NS SPGDPLVLERP Sbjct: 6 DTLISANIRVFESNSCSPGDPLVLERP 32 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 62 LELLVPNSXSPGDPLVLERP 3 + +L NS SPGDPLVLERP Sbjct: 1 MRVLASNSCSPGDPLVLERP 20 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 4 EFLQPGGSTSSRAAA 18 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 5 EFLQPGGSTSSRAAA 19 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 31 EFLQPGGSTSSRAAA 45 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 7 EFLQPGGSTSSRAAA 21 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 15 EFLQPGGSTSSRAAA 29 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 22 EFLQPGGSTSSRAAA 36 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 38 EFLQPGGSTSSRAAA 52 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 26 EFLQPGGSTSSRAAA 40 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 72 EFLQPGGSTSSRAAA 86 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 29 EFLQPGGSTSSRAAA 43 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 3 EFLQPGGSTSSRAAA 17 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 4 EFLQPGGSTSSRAAA 18 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 25 EFLQPGGSTSSRAAA 39 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 38 EFLQPGGSTSSRAAA 52 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 34 EFLQPGGSTSSRAAA 48 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 19 EFLQPGGSTSSRAAA 33 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 6 EFLQPGGSTSSRAAA 20 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 70 EFLQPGGSTSSRAAA 84 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 27 EFLQPGGSTSSRAAA 41 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 14 EFLQPGGSTSSRAAA 28 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 23 EFLQPGGSTSSRAAA 37 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 5 EFLQPGGSTSSRAAA 19 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 24 EFLQPGGSTSSRAAA 38 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 34 EFLQPGGSTSSRAAA 48 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 80 EFLQPGGSTSSRAAA 94 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 130 EFLQPGGSTSSRAAA 144 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 45 EFLQPGGSTSSRAAA 1 EFLQPGGSTSSRAAA Sbjct: 34 EFLQPGGSTSSRAAA 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,996,678 Number of Sequences: 59808 Number of extensions: 304304 Number of successful extensions: 3006 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3006 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -