BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060574.seq (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0103 - 773727-774737,774797-774813,774852-775078,777465-77... 29 4.6 12_01_1052 + 10821964-10822064,10822434-10822607,10823086-108233... 28 8.0 >01_01_0103 - 773727-774737,774797-774813,774852-775078,777465-778237 Length = 675 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 204 PKRGYVRVVVSAIPGVSNDAWDLGDDEIISGIXDTKISKSI 326 P+ + V IPG S+D+WDLG D++I+ + S+ + Sbjct: 115 PRSDQLPYVGLGIPG-SHDSWDLGLDDMITWVGFVNCSQEL 154 >12_01_1052 + 10821964-10822064,10822434-10822607,10823086-10823346, 10829833-10831798,10832114-10832515 Length = 967 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +3 Query: 183 EALPKGHPKRGYVRVVVSAIPGVSNDAWDLGDDEIISGIXDTKISKSISETAAL 344 EAL G +RV VS + G +D W L E ++ + T ++ +S+ A L Sbjct: 838 EALGWGLTGEEILRVAVSGLEGTQDDDWKL--QEALASLCATVFNRIVSKDADL 889 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,056,313 Number of Sequences: 37544 Number of extensions: 297496 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -