BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060574.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 3.0 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 24 5.2 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 6.8 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 9.0 AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding pr... 23 9.0 AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 23 9.0 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 543 AVSLNWSASSRYTISTVRQPRRTS 614 A S+NW S+ YT+S R R T+ Sbjct: 179 ASSMNWRVSNAYTLSDHRVIRYTA 202 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 118 PEHDKGLLSDTFWRTPQRAVPGRPYQRVIPNE 213 P ++ ++DT R +V P+QR+I N+ Sbjct: 40 PNNNSNWVTDTTGRVAVVSVGDYPFQRIIDNQ 71 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 207 WDDPLVRPPRYSALRC 160 W+D +V PP Y A C Sbjct: 292 WNDWIVAPPGYEAYYC 307 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 213 LVWDDPLVRPPRYSALRC 160 L WDD ++RP Y A C Sbjct: 192 LKWDDWIIRPHGYYANYC 209 >AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding protein AgamOBP35 protein. Length = 277 Score = 23.0 bits (47), Expect = 9.0 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = +3 Query: 99 YYGKSRTRT*QGFVV*HVLEDTSARCTGEALPKGHPKRGYVRVVVSAIPGVSNDA 263 YYG+ F + V EDT + G P G + + V+ S DA Sbjct: 150 YYGEDLQLAYDLFDMLDVSEDTRRKLAGGCFPSGPESQCFFFAYVTRFGAWSKDA 204 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 23.0 bits (47), Expect = 9.0 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = +3 Query: 99 YYGKSRTRT*QGFVV*HVLEDTSARCTGEALPKGHPKRGYVRVVVSAIPGVSNDA 263 YYG+ F + V EDT + G P G + + V+ S DA Sbjct: 150 YYGEDLQLAYDLFDMLDVSEDTRRKLAGGCFPSGPESQCFFFAYVTRFGAWSKDA 204 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,052 Number of Sequences: 2352 Number of extensions: 10745 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -