BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060572.seq (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transfera... 37 0.014 At1g73880.1 68414.m08556 UDP-glucoronosyl/UDP-glucosyl transfera... 37 0.014 At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transfera... 36 0.019 At2g15480.1 68415.m01771 UDP-glucoronosyl/UDP-glucosyl transfera... 36 0.025 At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.044 At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.044 At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.044 At1g78270.1 68414.m09121 UDP-glucose glucosyltransferase, putati... 35 0.044 At5g14860.1 68418.m01743 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.058 At1g24100.1 68414.m03041 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.058 At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.058 At5g05880.1 68418.m00647 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.076 At3g21560.1 68416.m02719 UDP-glucosyltransferase, putative simil... 34 0.076 At2g26480.1 68415.m03177 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.076 At5g17040.1 68418.m01997 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.10 At5g17030.1 68418.m01996 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.10 At4g14090.1 68417.m02175 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.10 At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.10 At4g34138.1 68417.m04844 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.18 At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.18 At2g36790.1 68415.m04512 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.18 At2g30140.1 68415.m03668 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.23 At5g66690.1 68418.m08407 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.31 At2g31750.1 68415.m03877 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.31 At1g22370.2 68414.m09509 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.31 At1g22370.1 68414.m09508 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.31 At5g05860.1 68418.m00644 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At4g36770.1 68417.m05217 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At4g15550.1 68417.m02376 UDP-glucose:indole-3-acetate beta-D-glu... 32 0.41 At3g53150.1 68416.m05857 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At2g36800.1 68415.m04513 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At1g22380.1 68414.m02799 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At1g05680.1 68414.m00589 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.41 At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.54 At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.54 At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.54 At5g65550.1 68418.m08248 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.71 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.71 At3g55700.1 68416.m06188 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.94 At2g43820.1 68415.m05447 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.94 At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.94 At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.94 At2g23250.1 68415.m02777 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.94 At1g22340.1 68414.m02795 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.94 At1g05560.1 68414.m00573 UDP-glucose transferase (UGT75B2) simil... 31 0.94 At5g26310.1 68418.m03145 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At4g34135.1 68417.m04842 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At3g50740.1 68416.m05552 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At2g23210.1 68415.m02772 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At3g55710.1 68416.m06189 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At3g21780.1 68416.m02747 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At1g22400.1 68414.m02801 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At1g01420.1 68414.m00057 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At5g03490.1 68418.m00305 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.2 At2g43840.2 68415.m05450 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.2 At2g43840.1 68415.m05449 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.2 At1g22360.1 68414.m02797 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.2 At5g05870.1 68418.m00645 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.9 At3g11420.1 68416.m01393 fringe-related protein similar to hypot... 29 2.9 At1g45191.2 68414.m05184 glycosyl hydrolase family 1 protein Sin... 29 2.9 At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.9 At5g17050.1 68418.m01998 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.8 At4g01070.1 68417.m00145 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.8 At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.0 At5g12890.1 68418.m01479 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.0 At5g25030.1 68418.m02966 hypothetical protein 28 6.6 At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transfera... 28 6.6 At2g34700.1 68415.m04262 pollen Ole e 1 allergen and extensin fa... 27 8.8 At1g78200.2 68414.m09113 protein phosphatase 2C, putative / PP2C... 27 8.8 At1g78200.1 68414.m09112 protein phosphatase 2C, putative / PP2C... 27 8.8 At1g01390.1 68414.m00054 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.8 >At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 450 Score = 36.7 bits (81), Expect = 0.014 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDWXPVL 662 NW Q+ VL+H+ + F+T G S+ E+ G+PM W +L Sbjct: 329 NWAPQQEVLKHQAIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLL 375 >At1g73880.1 68414.m08556 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 473 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q AVLRH+ + AF+T G S EA AG+ M Sbjct: 340 RGLVIRGWAPQVAVLRHRAVGAFLTHCGWNSVVEAVVAGVLM 381 >At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 484 Score = 36.3 bits (80), Expect = 0.019 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 486 KKHNVARHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ N + +I + W Q +L HK + F+T G S+ E AG+PM Sbjct: 342 EERNKGKGLIIRGWAPQVLILDHKAIGGFVTHCGWNSTLEGIAAGLPM 389 >At2g15480.1 68415.m01771 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 372 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 486 KKHNVARHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 K+ + +I W Q +L HK + F+T G S+ E AG+PM Sbjct: 230 KERTTGKGLIIPGWAPQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPM 277 >At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 462 Score = 35.1 bits (77), Expect = 0.044 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ ++W Q VL HK + F+T G S EA AG+PM Sbjct: 336 MVVKSWAPQVPVLNHKAVGGFVTHCGWNSILEAVCAGVPM 375 >At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 446 Score = 35.1 bits (77), Expect = 0.044 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ ++W Q VL HK + F+T G S EA AG+PM Sbjct: 336 MVVKSWAPQVPVLNHKAVGGFVTHCGWNSILEAVCAGVPM 375 >At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 451 Score = 35.1 bits (77), Expect = 0.044 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ ++W Q VL HK + F+T G S EA AG+PM Sbjct: 336 MVVKSWAPQVPVLNHKAVGGFVTHCGWNSILEAVCAGVPM 375 >At1g78270.1 68414.m09121 UDP-glucose glucosyltransferase, putative similar to UDP-glucose glucosyltransferase GI:3928543 from [Arabidopsis thaliana] Length = 489 Score = 35.1 bits (77), Expect = 0.044 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W +Q VL H + F+T G S+ E+ AG+PM Sbjct: 355 RGMLIKGWCSQEKVLSHPAIGGFLTHCGWNSTLESLYAGVPM 396 >At5g14860.1 68418.m01743 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 486 Score = 34.7 bits (76), Expect = 0.058 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +I ++W +Q +L HK + F++ G S+ E+ AG+P+ Sbjct: 345 MIVRDWVDQWEILSHKSVKGFLSHCGWNSAQESICAGVPL 384 >At1g24100.1 68414.m03041 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 460 Score = 34.7 bits (76), Expect = 0.058 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 +W NQ VL H+ + F+T G S+ E G+PM V W Sbjct: 335 SWCNQLEVLAHESIGCFLTHCGWNSTLEGLSLGVPM-VGVPQW 376 >At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum] GI:7385017; contains Pfam profiles PF00201: UDP-glucoronosyl and UDP-glucosyl transferase, PF01535: PPR repeat Length = 1184 Score = 34.7 bits (76), Expect = 0.058 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 513 ITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +T +W Q VL HK + F+T G S+ E G+PM Sbjct: 327 LTVSWSPQLEVLTHKSIGCFVTHCGWNSTLEGLSLGVPM 365 >At5g05880.1 68418.m00647 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 451 Score = 34.3 bits (75), Expect = 0.076 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDWXPVL 662 W Q+ VL+H+ + F+T G S+ E+ G+PM W +L Sbjct: 331 WAPQQEVLKHRAIGGFLTHNGWNSTVESVCEGVPMICLPFRWDQLL 376 >At3g21560.1 68416.m02719 UDP-glucosyltransferase, putative similar to UDP-glucose:sinapate glucosyltransferase GI:9794913 from [Brassica napus] Length = 496 Score = 34.3 bits (75), Expect = 0.076 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIP 626 W +Q VL H +A F+T G S+ EA +G+P Sbjct: 349 WCSQEKVLSHPSVACFVTHCGWNSTMEAVSSGVP 382 >At2g26480.1 68415.m03177 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 452 Score = 34.3 bits (75), Expect = 0.076 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q+ VLRH+ + F GG S E+ +G+PM Sbjct: 328 WAPQKEVLRHRAVGGFWNHGGWNSCLESISSGVPM 362 >At5g17040.1 68418.m01997 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP glucose:flavonoid 3-o-glucosyltransferase GI:13620861 from [Vitis vinifera]; contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 442 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q +L H+ M F++ GG S E+ AG+PM Sbjct: 321 WAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPM 355 >At5g17030.1 68418.m01996 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP glucose:flavonoid 3-o-glucosyltransferase from Vitis vinifera, EMBL:AF000372 Length = 459 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q +L H+ M F++ GG S E+ AG+PM Sbjct: 337 WAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPM 371 >At4g14090.1 68417.m02175 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase ;similar to UDP-glucose:anthocyanin 5-O-glucosyltransferase GI:4115563 from [Verbena x hybrida] Length = 456 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W +Q AVL H + F+T G S+ E+ E+G+P+ Sbjct: 333 WCSQTAVLAHCAVGCFVTHCGWNSTLESLESGVPV 367 >At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +3 Query: 489 KHNVARHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +H + + +W +Q VLRH+ + F+T G SS E+ G+P+ Sbjct: 322 RHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPV 368 >At4g34138.1 68417.m04844 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 488 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +I + W Q +L HK + F+T G S E AG+PM Sbjct: 350 LIIRGWAPQVLILEHKAIGGFLTHCGWNSLLEGVAAGLPM 389 >At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 +W Q VL H +A F+T G S+ E+ +G+P+ V W Sbjct: 354 DWCPQEQVLSHPSVACFVTHCGWNSTMESLSSGVPV-VCCPQW 395 >At2g36790.1 68415.m04512 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 495 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H + F+T G S+ E AG+PM Sbjct: 348 RGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPM 389 >At2g30140.1 68415.m03668 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 513 ITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDWXPVL 662 + +W +Q VL HK + F T G S+ E +G+PM W +L Sbjct: 322 VVVSWCDQLRVLCHKAVGGFWTHCGFNSTLEGIYSGVPMLAFPLFWDQIL 371 >At5g66690.1 68418.m08407 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R + +W Q +L H+ + F+T G S+ E+ G+PM Sbjct: 338 RGFVVPSWAPQAEILSHRAVGGFLTHCGWSSTLESVVGGVPM 379 >At2g31750.1 68415.m03877 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM-GVSAHDWXP 656 NW Q VL HK + F+T G S+ EA G+ + G+ A+ P Sbjct: 330 NWSPQLQVLAHKSIGCFMTHCGWNSTLEALSLGVALIGMPAYSDQP 375 >At1g22370.2 68414.m09509 UDP-glucoronosyl/UDP-glucosyl transferase family protein glycosyltransferase family Length = 479 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +W Q VL H + F+T G S+ E+ G+PM Sbjct: 356 SWCPQEKVLSHPAVGGFLTHSGWNSTLESLSGGVPM 391 >At1g22370.1 68414.m09508 UDP-glucoronosyl/UDP-glucosyl transferase family protein glycosyltransferase family Length = 309 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +W Q VL H + F+T G S+ E+ G+PM Sbjct: 186 SWCPQEKVLSHPAVGGFLTHSGWNSTLESLSGGVPM 221 >At5g05860.1 68418.m00644 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 450 Score = 31.9 bits (69), Expect = 0.41 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDWXPVL 662 W Q+ VL H+ F+T G S+ E+ G+PM W +L Sbjct: 330 WAPQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQML 375 >At4g36770.1 68417.m05217 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 457 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ + W Q +L HK F+T G S E+ G+PM Sbjct: 338 LVVRTWAPQEEILAHKSTGGFVTHCGWNSVLESIVNGVPM 377 >At4g15550.1 68417.m02376 UDP-glucose:indole-3-acetate beta-D-glucosyltransferase (IAGLU) identical to UDP-glucose:indole-3-acetate beta-D-glucosyltransferase (iaglu) GI:2149126 from [Arabidopsis thaliana] Length = 474 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 +W +Q VL H+ + F+T G S+ E+ +G+P+ V+ W Sbjct: 348 SWCDQFRVLNHRSIGCFVTHCGWNSTLESLVSGVPV-VAFPQW 389 >At3g53150.1 68416.m05857 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 507 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H F+T G S+ EA G+PM Sbjct: 351 RGIVIKGWSPQAMILSHGSTGGFLTHCGWNSTIEAICFGVPM 392 >At2g36800.1 68415.m04513 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 495 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H + F+T G S+ E AG+P+ Sbjct: 348 RGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPL 389 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 513 ITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 + W Q +L H+ ++ F+T G S+ E AG+P+ V+ W Sbjct: 327 VVLEWSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPV-VAYPSW 371 >At1g22380.1 68414.m02799 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 467 Score = 31.9 bits (69), Expect = 0.41 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++T +W Q VL H + F+T G S+ E+ G+PM Sbjct: 356 RRMLT-SWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPM 396 >At1g05680.1 68414.m00589 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +W Q VL HK + F+T G S+ E G+PM Sbjct: 330 SWSPQLDVLAHKSIGCFLTHCGWNSTLEGLSLGVPM 365 >At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDWXPVL 662 W Q+ VL+H+ + F+T G S+ E+ +PM W +L Sbjct: 335 WAPQQDVLKHRAIGGFLTHNGWSSTVESVCEAVPMICLPFRWDQML 380 >At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H + F+T G S+ E AG+P+ Sbjct: 343 RGLVIKGWAPQVFILSHASIGGFLTHCGWNSTLEGITAGVPL 384 >At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 478 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +I ++W +Q +L H+ + F++ G S+ E+ G+P+ Sbjct: 337 MIVRDWVDQWEILSHESVKGFLSHCGWNSAQESICVGVPL 376 >At5g65550.1 68418.m08248 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase ;similar to flavonol 3-O-glucosyltransferase (anthocyanin rhamnosyl transferase) from Petunia hybrida [SP|Q43716] Length = 466 Score = 31.1 bits (67), Expect = 0.71 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R VI W Q +L H + F+T G S+ E G+P+ Sbjct: 334 RGVIWTEWVPQTKILSHGSVGGFVTHCGWGSAVEGLSFGVPL 375 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H + F+T G S+ E +G+P+ Sbjct: 349 RSLLIKGWSPQMLILSHPAVGGFLTHCGWNSTLEGITSGVPL 390 >At3g55700.1 68416.m06188 UDP-glucoronosyl/UDP-glucosyl transferase family protein glucuronosyl transferase homolog, Lycopersicon esculentum, PIR:S39507 ;contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 460 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W NQ VL H + AF T G S+ E+ G+PM Sbjct: 333 WANQLEVLAHPAIGAFWTHCGWNSTLESICEGVPM 367 >At2g43820.1 68415.m05447 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 30.7 bits (66), Expect = 0.94 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 W Q VL +K + F+T G S+ EA G+PM V+ W Sbjct: 324 WSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPM-VAMPQW 364 >At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 30.7 bits (66), Expect = 0.94 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H + F+T G S+ E +GIP+ Sbjct: 349 RGLLIKGWAPQVLILSHPSVGGFLTHCGWNSTLEGITSGIPL 390 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 30.7 bits (66), Expect = 0.94 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L H + F+T G S+ E +GIP+ Sbjct: 349 RGLLIKGWSPQVLILSHPSVGGFLTHCGWNSTLEGITSGIPL 390 >At2g23250.1 68415.m02777 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains similarity to glucosyltransferases Length = 438 Score = 30.7 bits (66), Expect = 0.94 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 V+T+ W Q +L H ++ FIT G S+ E G+P+ Sbjct: 309 VVTE-WGQQEKILSHMAISCFITHCGWNSTIETVVTGVPV 347 >At1g22340.1 68414.m02795 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase; similar to UDP-glucose glucosyltransferase GI:3928543 from [Arabidopsis thaliana] Length = 487 Score = 30.7 bits (66), Expect = 0.94 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +W Q VL H + F+T G S+ E+ G+PM Sbjct: 362 SWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPM 397 >At1g05560.1 68414.m00573 UDP-glucose transferase (UGT75B2) similar to UDP-glucose:indole-3-acetate beta-D-glucosyltransferase GI:2149127 from (Arabidopsis thaliana); identical to cDNA UDP-glucosyltransferase (UGT75B2) GI:13661274 Length = 469 Score = 30.7 bits (66), Expect = 0.94 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +3 Query: 489 KHNVARHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +H + + +W +Q VL H+ + F+T G S+ E+ G+P+ Sbjct: 319 RHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPV 365 >At5g26310.1 68418.m03145 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R + +W Q +L H+ + F+T G S+ E+ G+PM Sbjct: 338 RGFMIPSWAPQAEILAHQAVGGFLTHCGWSSTLESVLCGVPM 379 >At4g34135.1 68417.m04842 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 483 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +I + W Q +L H+ F+T G S E AG+PM Sbjct: 349 MIIRGWAPQVLILDHQATGGFVTHCGWNSLLEGVAAGLPM 388 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +I + W Q +L H+ F+T G S E AG+PM Sbjct: 349 MIIRGWAPQVLILDHQATCGFVTHCGWNSLLEGVAAGLPM 388 >At3g50740.1 68416.m05552 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 487 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R + +W Q +L H+ + F+T G S E+ G+PM Sbjct: 343 RGFMVSSWAPQAEILAHQAVGGFLTHCGWNSILESVVGGVPM 384 >At2g23210.1 68415.m02772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q +L H ++ F+T G S+ E +G+PM Sbjct: 319 WGQQEKILCHMAISCFVTHCGWNSTIETVVSGVPM 353 >At3g55710.1 68416.m06189 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 464 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W NQ L H + AF T G S+ E+ G+PM Sbjct: 337 WVNQLETLAHPAVGAFWTHCGWNSTIESICEGVPM 371 >At3g21780.1 68416.m02747 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 431 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGV 635 W Q A+L + F++ GG S+ E+ G+PM + Sbjct: 293 WAEQVAILAKPAIGGFVSHGGWNSTLESLWFGVPMAI 329 >At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 491 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ W Q +L H + F+T G S+ E +G+P+ Sbjct: 344 RGLLITGWSPQMLILTHPAVGGFLTHCGWNSTLEGITSGVPL 385 >At1g22400.1 68414.m02801 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 489 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +W Q VL H + F+T G S E+ G+PM Sbjct: 362 SWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPM 397 >At1g01420.1 68414.m00057 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ +W Q +L H + F+T G SS E+ G+P+ Sbjct: 341 LVVGSWAPQAQILTHTSIGGFLTHCGWNSSLESIVNGVPL 380 >At5g03490.1 68418.m00305 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 465 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAG 620 R ++ + W +Q AVLRH + F++ G S E +G Sbjct: 334 RGLVVRGWVSQLAVLRHVAVGGFLSHCGWNSVLEGITSG 372 >At2g43840.2 68415.m05450 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 W Q VL +K + F+T G S+ E G+PM V+ W Sbjct: 324 WSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPM-VAMPQW 364 >At2g43840.1 68415.m05449 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPMGVSAHDW 650 W Q VL +K + F+T G S+ E G+PM V+ W Sbjct: 324 WSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPM-VAMPQW 364 >At1g22360.1 68414.m02797 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 522 NWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 +W Q VL H + F+T G S+ E+ G+PM Sbjct: 358 SWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPM 393 >At5g05870.1 68418.m00645 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 464 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q VL H+ F+T G S+ E+ G+PM Sbjct: 337 WAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPM 371 >At3g11420.1 68416.m01393 fringe-related protein similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 505 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -2 Query: 321 TGLNLVNGALFTRWIPPPRYWTRATRVGCCQIWD--VGSAK 205 T L V L T P YW +A R CC++ + VG K Sbjct: 448 TRLTKVKRILVTSMKTDPEYWNKAPRRQCCEVMEGKVGKRK 488 >At1g45191.2 68414.m05184 glycosyl hydrolase family 1 protein Since this genomic sequence region is unfinished, the annotated gene may be missing a stop codon or start codon Length = 487 Score = 29.1 bits (62), Expect = 2.9 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = -1 Query: 310 FGQRRTFYKMDSSAKILDAGDTGRLLSNMG-CRFSKSNCTLLRSSSIVGVSGPNCCLSNA 134 FG F+ + A I G S G C F NCTL SS+ + G N L++A Sbjct: 179 FGNHVKFWTTINEANIFTIGGYNDGNSPPGRCSFPGRNCTLGNSSTETYIVGHNLLLAHA 238 Query: 133 LDMLAKILNSLYKRI 89 ++++ YK I Sbjct: 239 --SVSRLYKQKYKDI 251 >At1g30530.1 68414.m03735 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q +L+H+ M +T G S E+ AG+PM Sbjct: 332 WAPQVELLKHEAMGVNVTHCGWNSVLESVSAGVPM 366 >At5g17050.1 68418.m01998 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP glucose:flavonoid 3-o-glucosyltransferase, Vitis vinifera, EMBL:AF000372 Length = 460 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q +L+H+ F+T G S E+ G+PM Sbjct: 338 WAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPM 372 >At4g01070.1 68417.m00145 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 480 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q VL H F+T G S+ E+ +GIP+ Sbjct: 346 WAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPL 380 >At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 525 WFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 W Q VLRH + F + G S+ E+ G+PM Sbjct: 332 WAPQMEVLRHPAVGGFWSHCGWNSTVESIGEGVPM 366 >At5g12890.1 68418.m01479 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 488 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 504 RHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 R ++ + W Q +L HK F++ G S E+ G+P+ Sbjct: 350 RGLLVKKWAPQVDILSHKATCVFLSHCGWNSILESLSHGVPL 391 >At5g25030.1 68418.m02966 hypothetical protein Length = 193 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 348 FDLFIFASMTGLNLVNGALFTRWIPPPRYWTRATRVGCCQIWDVGSA 208 +DL A +GL L+ F +W P R + C I+ +GSA Sbjct: 140 WDLKALAEESGLRLIQRMQFIKWAFPSSSNKRESGSNCDFIYPIGSA 186 >At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose glucosyltransferase GI:453245 from [Manihot esculenta] Length = 479 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 498 VARHVITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 VA + W Q VL HK + F++ G S+ E+ G+P+ Sbjct: 340 VAGRGLVCGWAPQVEVLAHKAIGGFVSHCGWNSTLESLWFGVPV 383 >At2g34700.1 68415.m04262 pollen Ole e 1 allergen and extensin family protein contains Pfam domain, PF01190: Pollen proteins Ole e I family Length = 175 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 283 SCKKCAVDQIKSGHRRENEQVKKRXXYVSFGSSIDTKSFANEFFYML 423 SCK VD + + VK G +++TK+ N +F+ML Sbjct: 56 SCKYSGVDTLLEASPLQGATVKLACNNTKRGVTMETKTDKNGYFFML 102 >At1g78200.2 68414.m09113 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C GB:CAA72341 [Medicago sativa]; contains Pfam profile: PF00481 Protein phosphatase 2C Length = 283 Score = 27.5 bits (58), Expect = 8.8 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = -3 Query: 272 RQDTGRGRHGSVVVKYGM-*VQQKQLHL-----VAQFFNCRCVGSKL-LFEQRVGHVGQN 114 + ++G+GR+G +KYG ++ K H VA+F N G++L LF GH G + Sbjct: 18 KSNSGKGRNGEGGIKYGFSLIKGKSNHSMEDYHVAKFTNFN--GNELGLFAIFDGHKGDH 75 Query: 113 FKFFIQTH 90 ++Q H Sbjct: 76 VAAYLQKH 83 >At1g78200.1 68414.m09112 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C GB:CAA72341 [Medicago sativa]; contains Pfam profile: PF00481 Protein phosphatase 2C Length = 283 Score = 27.5 bits (58), Expect = 8.8 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = -3 Query: 272 RQDTGRGRHGSVVVKYGM-*VQQKQLHL-----VAQFFNCRCVGSKL-LFEQRVGHVGQN 114 + ++G+GR+G +KYG ++ K H VA+F N G++L LF GH G + Sbjct: 18 KSNSGKGRNGEGGIKYGFSLIKGKSNHSMEDYHVAKFTNFN--GNELGLFAIFDGHKGDH 75 Query: 113 FKFFIQTH 90 ++Q H Sbjct: 76 VAAYLQKH 83 >At1g01390.1 68414.m00054 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 480 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 510 VITQNWFNQRAVLRHKKMAAFITQGGLQSSDEAXEAGIPM 629 ++ +W Q +L H F+T G S+ E+ G+P+ Sbjct: 341 LVVPSWAPQVQILAHPSTCGFLTHCGWNSTLESIVNGVPL 380 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,464,884 Number of Sequences: 28952 Number of extensions: 312967 Number of successful extensions: 873 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -