BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060570.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 45 5e-07 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 45.2 bits (102), Expect = 5e-07 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 4/63 (6%) Frame = +3 Query: 501 KELVGVXQTGSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTRELAQQIPQVA 668 ++L+ QTGSGKT A++LP I ++ + PP + P+ ++++PTRELA QI Sbjct: 196 RDLMSCAQTGSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQG 255 Query: 669 AXF 677 F Sbjct: 256 KKF 258 Score = 39.9 bits (89), Expect = 2e-05 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +1 Query: 349 EVTVSGVXVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 507 EV V+G PI FE + ++ + VK GY +PT IQ P+ +SG++ Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRD 197 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,880 Number of Sequences: 336 Number of extensions: 3118 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -