BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060561.seq (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23565| Best HMM Match : Cytochrom_C1 (HMM E-Value=3.8e-15) 122 4e-28 SB_8522| Best HMM Match : Cytochrom_C1 (HMM E-Value=1.2e-06) 50 1e-06 SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) 30 1.5 SB_50798| Best HMM Match : CBS (HMM E-Value=2.8) 30 1.5 SB_49990| Best HMM Match : PAN (HMM E-Value=0.12) 30 1.5 SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) 30 1.5 SB_46740| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_39727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) 30 1.5 SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15) 30 1.5 SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) 30 1.5 SB_59576| Best HMM Match : rve (HMM E-Value=3.7e-14) 30 1.5 SB_55917| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_24375| Best HMM Match : rve (HMM E-Value=7.2e-15) 30 1.5 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 30 1.5 SB_50560| Best HMM Match : rve (HMM E-Value=7.2e-15) 29 3.5 SB_23782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_48339| Best HMM Match : BAG (HMM E-Value=5.9) 28 6.2 SB_39330| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_5356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_4819| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) 28 8.1 >SB_23565| Best HMM Match : Cytochrom_C1 (HMM E-Value=3.8e-15) Length = 134 Score = 122 bits (293), Expect = 4e-28 Identities = 55/98 (56%), Positives = 69/98 (70%) Frame = +2 Query: 215 PTSQPLESQWLVQPLDHASVRRGYEVYKQVCKACHSLQYIAFRNLVNVTHTEDEAKAEAA 394 P P + +DH S+RRG++VY+QVC ACHS+ +AFR+LV V +TEDE KA AA Sbjct: 34 PPKLPWSHNGVFNSIDHDSIRRGFQVYRQVCAACHSMNRLAFRHLVGVCYTEDEMKAIAA 93 Query: 395 EVMIKDGPDEEGNYFERPGKLSDYLPSPYPNENAARAA 508 E + DGP+++G F RPGKLSD LP PY NE AARAA Sbjct: 94 EYDVVDGPNDQGEMFTRPGKLSDPLPEPYANEEAARAA 131 Score = 32.7 bits (71), Expect = 0.29 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 171 FALEQSVQASGSEAHPPHNPWNHSGWFS 254 + L+ V A E HPP PW+H+G F+ Sbjct: 19 YLLQPDVHAEELELHPPKLPWSHNGVFN 46 >SB_8522| Best HMM Match : Cytochrom_C1 (HMM E-Value=1.2e-06) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = +1 Query: 568 DYIFALLTGYMEPPAGVVLREGQNYNPYXPGGAISM 675 DY+F LLTGY +PPAGV +R+ +N Y PG AI M Sbjct: 1 DYVFHLLTGYADPPAGVEIRDDLYFNAYFPGQAIGM 36 >SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) Length = 942 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 616 DGCTDCNRNAPSQAATPPLPTSP 638 >SB_50798| Best HMM Match : CBS (HMM E-Value=2.8) Length = 234 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 173 DGCTDCNRNAPSQAATPPLPTSP 195 >SB_49990| Best HMM Match : PAN (HMM E-Value=0.12) Length = 310 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = +2 Query: 341 RNLVNVTHTEDEAKAEAA----EVMIKDGPDEEGNYFERPGKLSD 463 +N++N ++ EA A+ + E++ K+GP +G Y+ PG S+ Sbjct: 39 KNMMNANESDIEADADFSLFNREILDKEGPGPDGEYYIDPGSGSN 83 >SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) Length = 1286 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 1157 DGCTDCNRNAPSQAATPPLPTSP 1179 >SB_46740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 73 DGCTDCNRNAPSQAATPPLPTSP 95 >SB_39727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 124 DGCTDCNRNAPSQAATPPLPTSP 146 >SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) Length = 1600 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 635 DGCTDCNRNAPSQAATPPLPTSP 657 >SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15) Length = 1485 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 1249 DGCTDCNRNAPSQAATPPLPTSP 1271 >SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) Length = 1213 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 790 DGCTDCNRNAPSQAATPPLPTSP 812 >SB_59576| Best HMM Match : rve (HMM E-Value=3.7e-14) Length = 707 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 450 DGCTDCNRNAPSQAATPPLPTSP 472 >SB_55917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1412 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 846 DGCTDCNRNAPSQAATPPLPTSP 868 >SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 275 DGCTDCNRNAPSQAATPPLPTSP 297 >SB_24375| Best HMM Match : rve (HMM E-Value=7.2e-15) Length = 638 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 453 DGCTDCNRNAPSQAATPPLPTSP 475 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT+P Sbjct: 232 DGCTDCNRNAPSQAATPPLPTSP 254 >SB_50560| Best HMM Match : rve (HMM E-Value=7.2e-15) Length = 364 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -2 Query: 199 DACTDCS-SAKSRAPTPP-PTTP 137 D CTDC+ +A S+A TPP PT P Sbjct: 173 DGCTDCNRNAPSQAATPPLPTYP 195 >SB_23782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = -2 Query: 646 DCSSVPHVALHQQEVPCNQSVARRCNLRRPYVPSRSE 536 D + P + L + E+PCN +A+ N+++ + P ++ Sbjct: 26 DSNQQPRINLQENEIPCN--IAQPVNIKKSFEPDSNQ 60 >SB_48339| Best HMM Match : BAG (HMM E-Value=5.9) Length = 404 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 649 MDCSSVPHVALHQQEVPCNQSVARRCNLRRPYVPSRSETSPVGK 518 ++C ++ + Q+E+ QSVARR N+ R +RS SP G+ Sbjct: 340 VECLKFCYMGVLQREL---QSVARRWNIHRIRPSTRSNISPPGR 380 >SB_39330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 649 MDCSSVPHVALHQQEVPCNQSVARRCNLRRPYVPSRSETSPVGK 518 ++C ++ + Q+E+ QSVARR N+ R +RS SP G+ Sbjct: 16 VECLKFCYMGVLQREL---QSVARRWNIHRIRPSTRSNISPPGR 56 >SB_5356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 649 MDCSSVPHVALHQQEVPCNQSVARRCNLRRPYVPSRSETSPVGK 518 ++C ++ + Q+E+ QSVARR N+ R +RS SP G+ Sbjct: 112 VECLKFCYMGVLQREL---QSVARRWNIHRIRPSTRSNISPPGR 152 >SB_4819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 649 MDCSSVPHVALHQQEVPCNQSVARRCNLRRPYVPSRSETSPVGK 518 ++C ++ + Q+E+ QSVARR N+ R +RS SP G+ Sbjct: 112 VECLKFCYMGVLQREL---QSVARRWNIHRIRPSTRSNISPPGR 152 >SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) Length = 280 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 275 RRGYEVYKQVCKACHSLQYIAFRNL--VNVTHTEDEAKAEAAEVMIKDGPDEEGNYFE 442 +R Y YK+ KAC +Y F+ L + + +DE A+ +K+ P + +Y + Sbjct: 13 KRLYNNYKKSGKACDKEKYRKFQKLFKIKMKKAQDEYIADTLNSDLKEKPKKFWSYIK 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,152,349 Number of Sequences: 59808 Number of extensions: 520956 Number of successful extensions: 1674 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1671 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -