SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060549.seq
         (687 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    25   0.77 
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    21   9.5  

>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 24.6 bits (51), Expect = 0.77
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +2

Query: 476 LGVKQLIVGVNKWIPLNHHTVSPDL-RKSRRKYPHTSRRLGYNPAAVAFVPISGWHGD 646
           LG+K L + +++   L  + ++P L RKS  KY         +      VPISG H D
Sbjct: 344 LGMKYLDMVISE--TLRKYPLAPFLNRKSDVKYTFEETGFTLDKGVSIMVPISGLHYD 399


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 334 QRFHQEHDHRNLS 372
           + FH+EHD R  S
Sbjct: 260 RHFHEEHDTRRAS 272


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,594
Number of Sequences: 336
Number of extensions: 3669
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18010165
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -