BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060546.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 25 2.2 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.8 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 481 QLSVVKNSKCIHISSINRRNGCCRSS 558 Q K +K I I +NGCCR + Sbjct: 185 QKKQTKQNKKIQIKHTKTKNGCCRKT 210 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 143 KNFKISRDALVLEIKVGMGLWNHMVLTGDFN 51 +N+ S A + + + M +H++L GDFN Sbjct: 127 RNYFESLSAFIXDAYMHMKPNDHLILLGDFN 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,445 Number of Sequences: 2352 Number of extensions: 11547 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -