BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060545.seq (563 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.1 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 2.8 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 6.5 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 188 LLSAMPRKNCGQVSISASRTNVSFTPDETGSKFSL 292 LL+A+P + + +T S +P E SK + Sbjct: 525 LLNALPPSSMKETEEEKKKTKQSLSPSENQSKMEI 559 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 117 LLNTTHYKTMSHKSLIMAK 61 L NT H K +SH L+ AK Sbjct: 294 LENTDHTKQLSHDVLLRAK 312 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.4 bits (43), Expect = 6.5 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 519 LXLFGLWWKW 548 + LF LWW W Sbjct: 226 MGLFVLWWGW 235 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,990 Number of Sequences: 438 Number of extensions: 2582 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -