BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060538.seq (675 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 104 6e-23 At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 101 4e-22 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 66 2e-11 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 43 2e-04 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 41 9e-04 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 38 0.006 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.008 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 38 0.008 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 37 0.011 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 37 0.011 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 36 0.019 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.025 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 35 0.043 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 35 0.043 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 35 0.043 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.057 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 33 0.13 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 33 0.23 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 32 0.30 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 32 0.30 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 32 0.30 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 32 0.30 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 32 0.40 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 32 0.40 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 31 0.53 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 31 0.53 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 31 0.93 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 31 0.93 At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revo... 30 1.2 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 30 1.2 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 30 1.2 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 30 1.2 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 30 1.6 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 1.6 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 29 2.1 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 3.8 At2g40070.1 68415.m04923 expressed protein 28 5.0 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 6.6 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 28 6.6 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.7 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 104 bits (249), Expect = 6e-23 Identities = 50/155 (32%), Positives = 75/155 (48%) Frame = +2 Query: 170 TGGMAASAAVPTESCEFGSPKYFALCGVVVFCHAV*XHTAVVPLDLVKCRLQVDAEKYKN 349 + G + + A P E E SP YFA C V HTA+ PLD++KC +Q+D KYKN Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPLKYKN 104 Query: 350 VVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFRFL*SVQSXXXXXXXXXXXXXXXX 529 + + FK +++E+G++G +GW+PT +GYS QG K+ + Sbjct: 105 ITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYYSDIVGPEYAAKYKT 164 Query: 530 XXVPGGRLRXRNSSPTIACRPWKPLXVRIQXMPGF 634 G + C P + + VR+Q PGF Sbjct: 165 LIYLAGSASAEIVADVALC-PMEAVKVRVQTQPGF 198 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 101 bits (242), Expect = 4e-22 Identities = 59/191 (30%), Positives = 90/191 (47%), Gaps = 2/191 (1%) Frame = +2 Query: 68 MFSSLLDAARNSPFRGPLSTAQCQSTVAPVAIEQTGGMAASAAVPTESCEFGSPKYFALC 247 + +L++ N+ F S A S + I + + AS P + E SP ++A C Sbjct: 24 LLDQVLNSNSNAAFEKSPSPAPRSSPTS--MISRKNFLIASPTEPGKGIEMYSPAFYAAC 81 Query: 248 --GVVVFCHAV*XHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 421 G ++ C H V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT Sbjct: 82 TFGGILSCGLT--HMTVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPT 139 Query: 422 FIGYSMQGLCKFRFL*SVQSXXXXXXXXXXXXXXXXXXVPGGRLRXRNSSPTIACRPWKP 601 +GYS QG CKF F + G + C P++ Sbjct: 140 LLGYSAQGACKFGFYEYFKKTYSDLAGPEYTAKYKTLIYLAGSASAEIIADIALC-PFEA 198 Query: 602 LXVRIQXMPGF 634 + VR+Q PGF Sbjct: 199 VKVRVQTQPGF 209 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 66.5 bits (155), Expect = 2e-11 Identities = 29/81 (35%), Positives = 47/81 (58%) Frame = +2 Query: 215 EFGSPKYFALCGVVVFCHAV*XHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVR 394 E SP ++ +C + A H A+ PLD++K +QV+ KY ++ +GF +RE G Sbjct: 11 ELSSPWFYTVCTMGGMLSAGTTHLAITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHS 70 Query: 395 GLAKGWAPTFIGYSMQGLCKF 457 L +GW+ +GY +QG C+F Sbjct: 71 YLWRGWSGKLLGYGVQGGCRF 91 Score = 30.7 bits (66), Expect = 0.93 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 287 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 418 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/56 (39%), Positives = 29/56 (51%) Frame = +2 Query: 263 CHAV*XHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 430 C V PL+LVK RL + YK + + F +REEG L +G AP+ IG Sbjct: 213 CAGVSQTLLTYPLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIG 268 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPT 421 TA PL++ + +QV A YKN+++ + EG+ G KG P+ Sbjct: 314 TATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPS 363 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 40.7 bits (91), Expect = 9e-04 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 430 +A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 157 SATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIG 209 Score = 36.7 bits (81), Expect = 0.014 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKG 409 TAV PL+ +K LQV KY V G K R EG+RGL KG Sbjct: 54 TAVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKG 98 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = +2 Query: 296 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P + Sbjct: 252 PLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRML 301 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEG 388 P+D+VK RLQ+ YK V + K REEG Sbjct: 152 PMDMVKQRLQIGNGTYKGVWDCIKRVTREEG 182 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +2 Query: 290 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 418 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 37.5 bits (83), Expect = 0.008 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 296 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFRFL 466 PLD++K RL V +YK V + K +REEG L KG P + + G F L Sbjct: 252 PLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVL 310 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 418 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVP 365 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 37.1 bits (82), Expect = 0.011 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +2 Query: 296 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAP 418 P+D++K RLQ+D YK + + G KV VR EGVR L KG P Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTP 74 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +2 Query: 290 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 421 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +2 Query: 296 PLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 418 P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 230 PFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 8/56 (14%) Frame = +2 Query: 284 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 T V PLD++K RLQV ++ ++ K ++EEG RG+ +G +PT I Sbjct: 33 TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTII 88 Score = 34.7 bits (76), Expect = 0.057 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Frame = +2 Query: 287 AVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 436 A PL +VK RL + YK+V++ F EEGVRGL G P+ G S Sbjct: 134 ATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVS 188 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 424 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 Score = 30.7 bits (66), Expect = 0.93 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Frame = +2 Query: 242 LCGVVVFCHAV*XHTAVVPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGV 391 +C C A +PLD K RLQ+ D E KY+ + REEG+ Sbjct: 17 ICSAFAACFA---ELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGI 73 Query: 392 RGLAKG 409 GL KG Sbjct: 74 SGLWKG 79 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 35.1 bits (77), Expect = 0.043 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 9/65 (13%) Frame = +2 Query: 296 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 448 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 449 CKFRF 463 KF F Sbjct: 193 LKFYF 197 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Frame = +2 Query: 296 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAP 418 P DLVK RLQ + + +Y +N + VR+EGVR L G P Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGP 181 Score = 35.1 bits (77), Expect = 0.043 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 424 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 Score = 31.9 bits (69), Expect = 0.40 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 9/73 (12%) Frame = +2 Query: 227 PKYFALCGVVVFCHAV*XHTAVVPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVR 379 PK FA C C +PLD K RLQ V KY+ ++ R Sbjct: 12 PKTFA-CSAFAACVG---EVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAR 67 Query: 380 EEGVRGLAKGWAP 418 EEG+R L KG P Sbjct: 68 EEGLRSLWKGVVP 80 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 35.1 bits (77), Expect = 0.043 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 457 PL+++K RL V E Y ++ R +G+RG G PT +G C + Sbjct: 179 PLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPYSTCYY 232 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGW 412 T PL++ + RL V A K + N+ V++EGV GL +GW Sbjct: 269 TISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGW 314 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 34.7 bits (76), Expect = 0.057 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +2 Query: 287 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKG 409 A PLD+VK RLQ Y+ + + F+ SV++EG L +G Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRG 257 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 296 PLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 433 PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 271 PLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +2 Query: 287 AVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 436 A PL +VK RLQ + YK+ + + EEG+RGL G P G S Sbjct: 130 ATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGIS 184 Score = 31.9 bits (69), Expect = 0.40 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 8/54 (14%) Frame = +2 Query: 284 TAVVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPT 421 T V PLD++K R QV DA K +V + + EG+RGL +G +PT Sbjct: 29 TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPT 82 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 424 + V PL +++ R+Q D+ K ++ F ++R EG++G +G P F Sbjct: 409 SCVYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNF 454 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 284 TAVVPLDLVKCRLQ--VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 430 TA+ P+DLVK RLQ V + K +EG R +G P+ IG Sbjct: 311 TAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIG 361 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 32.3 bits (70), Expect = 0.30 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 424 TA PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 287 TATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 32.3 bits (70), Expect = 0.30 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +2 Query: 296 PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 457 P D VK +LQ V +YKN ++ ++ EGV+GL +G +F+G + + F Sbjct: 34 PFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSFMGMAFESSLMF 92 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 8/52 (15%) Frame = +2 Query: 296 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLL 184 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 32.3 bits (70), Expect = 0.30 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 296 PLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTF 424 P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ Sbjct: 235 PADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTW 279 Score = 31.5 bits (68), Expect = 0.53 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +2 Query: 296 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 418 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 31.9 bits (69), Expect = 0.40 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +2 Query: 287 AVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIG 430 A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG Sbjct: 23 AMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIG 76 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 P+D+VK RLQ+ YK V + K +REEG+ + T + Sbjct: 150 PMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVL 193 Score = 31.1 bits (67), Expect = 0.70 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +2 Query: 296 PLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 PLD+VK +LQ D ++ + + V+++G RGL +GW P + Sbjct: 247 PLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRML 296 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 31.5 bits (68), Expect = 0.53 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +2 Query: 296 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 418 PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 297 PLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 31.5 bits (68), Expect = 0.53 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 6/53 (11%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 424 TA PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 259 TATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 30.7 bits (66), Expect = 0.93 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Frame = +2 Query: 242 LCGVVVFCHAV*XHTAVVPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGV 391 +C C A +PLD K RLQ+ D E KY+ + REEG+ Sbjct: 17 ICSAFAACFA---ELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGI 73 Query: 392 RGLAKG 409 GL KG Sbjct: 74 SGLWKG 79 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +2 Query: 287 AVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAKG 409 A P+D V+ R+ + +A KYK+ + F V++EG + L KG Sbjct: 307 ASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKG 350 >At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revoluta (REV) / fascicular fiberless 1 (IFL1) identical to HD-zip transcription factor Revoluta (GI:9759333) {Arabidopsis thaliana}; contains Pfam profiles PF01852: START domain and PF00046: Homeobox domain Length = 842 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 312 FTRSRGTTAVXCQTA*QNTTTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDW 136 + + + TT V + TTPQ + L D NS + + A+ + S ATG VDW Sbjct: 124 YMKQQLTTVVNDPSCESVVTTPQHS--LRDANSPAGLLSIAEETLAEFLSKATGTAVDW 180 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 30.3 bits (65), Expect = 1.2 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Frame = +2 Query: 185 ASAAVPTESCEFGSPKYFALCGVVVFCHAV*XHTAVVPLDLVKCRL--QVDAEKYKNVVN 358 AS + TE SP + G + C A P DL++ L Q + + Y + + Sbjct: 117 ASGSTKTEDHIHLSPYLSFVSGALAGCAAT---LGSYPFDLLRTILASQGEPKVYPTMRS 173 Query: 359 GFKVSVREEGVRGLAKGWAPTFI 427 F ++ G+RGL G PT + Sbjct: 174 AFVDIIQSRGIRGLYNGLTPTLV 196 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 332 AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 A KY +V K REEG RG +G P + Sbjct: 66 ASKYTGMVQATKDIFREEGFRGFWRGNVPALL 97 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +2 Query: 224 SPKYFALCGVVVFCHAV*XHTAVVPLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRG 397 SP + G + C A P DL++ L Q + + Y N+ + F V+ G++G Sbjct: 125 SPYLSYISGALAGCAAT---VGSYPFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKG 181 Query: 398 LAKGWAPTFI 427 L G +PT I Sbjct: 182 LYAGLSPTLI 191 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/59 (28%), Positives = 31/59 (52%) Frame = +2 Query: 251 VVVFCHAV*XHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 427 + F V T +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 122 IASFIGTVLGTTLRIPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +2 Query: 296 PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 445 PLD +K RLQV E + K + E+G +G +G P F S G Sbjct: 254 PLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAWG 305 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 287 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 430 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 284 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIG 430 TA+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 312 TAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLG 363 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 296 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 421 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 560 RNSSPTIACRPWKPLXVRIQXMPGF 634 R +SPT+ RPWKP MPGF Sbjct: 360 RAASPTVRSRPWKP-----SDMPGF 379 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 375 TDTLKPFTTFLYFSASTWRRHFTRSRG 295 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/49 (40%), Positives = 25/49 (51%) Frame = +2 Query: 188 SAAVPTESCEFGSPKYFALCGVVVFCHAV*XHTAVVPLDLVKCRLQVDA 334 S ++P E+ +FG A G F AV V PLD+VK RLQ A Sbjct: 11 SKSIPNENLKFGERALSA--GGAAFISAV----IVNPLDVVKTRLQAQA 53 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 317 RLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 457 R + EK + + GF+ V+ +G+ + +GWAP + Q C F Sbjct: 325 RKNIGIEKEEWLPEGFEERVKGKGM--IIRGWAPQVLILDHQATCGF 369 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,936,458 Number of Sequences: 28952 Number of extensions: 264931 Number of successful extensions: 793 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 776 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -