BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060536.seq (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 3.9 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 6.8 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 6.8 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 9.0 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 9.0 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 358 EVSD*RPSCRCIPDVVRSRDCKEAHRRVMYTPSRDGA 248 EV+ R +CR P + DC + R ++ TP+ G+ Sbjct: 8 EVNLSRRACR--PTTTNNDDCLQEQRTLLTTPTEGGS 42 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 6.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 612 SVRPAGEPTSVSTPATALRIQRRG 683 +VRP+ TS+S AT L+ Q G Sbjct: 841 NVRPSFTTTSISNGATTLQQQHAG 864 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 6.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 612 SVRPAGEPTSVSTPATALRIQRRG 683 +VRP+ TS+S AT L+ Q G Sbjct: 840 NVRPSFTTTSISNGATTLQQQHAG 863 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 358 QMAQFLCLRNI 390 QM QFLCL+N+ Sbjct: 540 QMQQFLCLQNV 550 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 280 DGVLLCNLLNVLHPGCIDMKDVNQRPQMAQFLCLRNIKVFLRTCH 414 +G+ L L + CI+ + +F+C ++ +RTCH Sbjct: 239 EGLFLPELYSYDEQSCIECAECRGLFSPQKFVCHQHEPQEIRTCH 283 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,855 Number of Sequences: 2352 Number of extensions: 16254 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -