BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060535.seq (544 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 0.75 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 0.99 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 3.0 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 9.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 9.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 9.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 9.2 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 9.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 9.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 9.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 9.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 9.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 9.2 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 24.2 bits (50), Expect = 0.75 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 120 TANINLYSER*HHLEQQYSGVNHQIREN 37 T N N + HH+ Q+ VNH + N Sbjct: 317 TNNQNHHHHAGHHIHAQHHVVNHHVAAN 344 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.8 bits (49), Expect = 0.99 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 397 QXAEKSPIHLQSPQLQFRGSLVQXLRDATKKLGL 498 Q +P HLQSP Q S D+T G+ Sbjct: 77 QPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 335 LIMMTITIVSTGMRYGRAYLSRXQRNHRFICSHLS 439 L+M +TI+ + + + + S +N +FI L+ Sbjct: 27 LVMSAVTIILSSLIFNQEQWSSLNKNFQFIDKKLN 61 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +1 Query: 361 EYRDEIWKSLLEQXAEKSPIHLQSPQLQ 444 ++RD+ + S+ E+ S + L PQ++ Sbjct: 133 KFRDKQYLSIAERAEFSSSLRLTEPQVK 160 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 297 NFWAAXGRSMXPDTHKFNLAI 235 N W A S PDT NL I Sbjct: 10 NTWRAFTASWSPDTLAKNLGI 30 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 41 HLQSPNTQTHPSASCKYADSTSSTGV 66 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 20.6 bits (41), Expect = 9.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 HLQSPQLQFRGSLVQXLRDATKKLGL 498 HLQSP Q S D+T G+ Sbjct: 85 HLQSPNTQTHPSASCKYADSTSSTGV 110 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,392 Number of Sequences: 336 Number of extensions: 2064 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -