BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060535.seq (544 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08850.1 68416.m01029 transducin family protein / WD-40 repea... 29 2.0 At2g40130.2 68415.m04936 heat shock protein-related contains sim... 27 8.1 >At3g08850.1 68416.m01029 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (5 copies, 1 weak) Length = 1344 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 259 VRXHASTXSGPKVEVADPKMNPVVLTDYDDDYHCEYRDEIWKSLLEQXAEKSPI 420 VR A G +++ VV ++DDD D I KSLL+ ++ SP+ Sbjct: 654 VRAAAVFALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPL 707 >At2g40130.2 68415.m04936 heat shock protein-related contains similarity to 101 kDa heat shock protein; HSP101 [Triticum aestivum] gi|11561808|gb|AAC83689 Length = 910 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +1 Query: 322 PVVLTDYDDDYHCEYRDEIWKSLLEQXAEKSPIHLQSPQLQFRGSLVQXLRDATKK 489 P T+ ++ YHCE +W L+ K I + F G L + ++ + K+ Sbjct: 773 PAQETEIEEKYHCEENSNVW--LMNLKNHKRLIEVPFKPFDFEG-LAEKIKKSVKE 825 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,106,741 Number of Sequences: 28952 Number of extensions: 172648 Number of successful extensions: 372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -