BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060534.seq (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14905| Best HMM Match : GIY-YIG (HMM E-Value=5.7) 29 3.5 SB_42267| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=5.9e-12) 28 8.0 >SB_14905| Best HMM Match : GIY-YIG (HMM E-Value=5.7) Length = 373 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 331 CWKYLATNKRIILQSVLPQLCKSTCRSIVRSKRTSVSKN*PK 206 CW Y +T + L Q+CK+T +I T + K+ PK Sbjct: 136 CWHYTSTKTTRETTTRLVQMCKNTSTNIGHRFLTLIDKHFPK 177 >SB_42267| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=5.9e-12) Length = 902 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 589 ANRLTINNEGPSPKRRVITVARHCRE 512 AN T EG +RR + +ARHC++ Sbjct: 749 ANNDTFTEEGLRRERRKVNLARHCKD 774 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,369,848 Number of Sequences: 59808 Number of extensions: 358671 Number of successful extensions: 956 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -