BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060534.seq (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 26 0.95 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 26 0.95 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 26 0.95 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 1.7 AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein prot... 23 6.7 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 8.9 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 26.2 bits (55), Expect = 0.95 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 514 EIWLTKARILCPATEIVSRTF 452 EI T+A + CP +EI+ TF Sbjct: 638 EIACTRANVTCPRSEIILETF 658 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 26.2 bits (55), Expect = 0.95 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 514 EIWLTKARILCPATEIVSRTF 452 EI T+A + CP +EI+ TF Sbjct: 638 EIACTRANVTCPRSEIILETF 658 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 26.2 bits (55), Expect = 0.95 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 514 EIWLTKARILCPATEIVSRTF 452 EI T+A + CP +EI+ TF Sbjct: 616 EIACTRANVTCPRSEIILETF 636 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.4 bits (53), Expect = 1.7 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -3 Query: 482 PG-NGDRIPYLLIDIEGKVTEKAYPLRLF----DPVKMRISWIKH 363 PG NG P ++D GKV EK RL DP +R+S +H Sbjct: 551 PGSNGSYRPLCMLDALGKVLEKLILNRLHNHLEDPAAVRLSDRQH 595 >AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein protein. Length = 163 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 529 ARHCREIWLTKARILCPATEIVS 461 A CRE+ L K+++ C A +S Sbjct: 23 AEDCRELGLIKSQLFCSACSSLS 45 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 435 ALDVYQKVRDTISVAGHKIRAFV 503 A D+ QK R + H++RAF+ Sbjct: 71 AFDIMQKDRREFNKRSHEVRAFL 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,621 Number of Sequences: 2352 Number of extensions: 12250 Number of successful extensions: 25 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -