BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060534.seq (679 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF399505-1|AAK94990.1| 218|Homo sapiens olfactory receptor prot... 31 2.8 AB065939-1|BAC06154.1| 264|Homo sapiens seven transmembrane hel... 31 2.8 AB065763-1|BAC05983.1| 323|Homo sapiens seven transmembrane hel... 31 2.8 >AF399505-1|AAK94990.1| 218|Homo sapiens olfactory receptor protein. Length = 218 Score = 31.5 bits (68), Expect = 2.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 258 HVLLHNCGKTLCKIILLFVAKYFQQLVHKCAQN 356 H L CG LC I++ +V +F L H +N Sbjct: 168 HKALSTCGSHLCVILMFYVPSFFTLLTHHFGRN 200 >AB065939-1|BAC06154.1| 264|Homo sapiens seven transmembrane helix receptor protein. Length = 264 Score = 31.5 bits (68), Expect = 2.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 258 HVLLHNCGKTLCKIILLFVAKYFQQLVHKCAQN 356 H L CG LC I++ +V +F L H +N Sbjct: 178 HKALSTCGSHLCVILMFYVPSFFTLLTHHFGRN 210 >AB065763-1|BAC05983.1| 323|Homo sapiens seven transmembrane helix receptor protein. Length = 323 Score = 31.5 bits (68), Expect = 2.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 258 HVLLHNCGKTLCKIILLFVAKYFQQLVHKCAQN 356 H L CG LC I++ +V +F L H +N Sbjct: 237 HKALSTCGSHLCVILMFYVPSFFTLLTHHFGRN 269 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,548,293 Number of Sequences: 237096 Number of extensions: 1578343 Number of successful extensions: 8230 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8230 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -