BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060533.seq (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 67 1e-11 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 29 2.6 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 66.9 bits (156), Expect = 1e-11 Identities = 26/60 (43%), Positives = 39/60 (65%) Frame = +1 Query: 313 RRKXCDVVSELARXHIDDDGNNQWPEFLQXMFNCASAQDPNIKEAGIGMFTXVPGVXGNR 492 R+K CD VSEL++ +DDDG N W E L+ +F C ++ +KE+ + +F PGV GN+ Sbjct: 75 RKKICDAVSELSKSFLDDDGYNHWQELLKFLFECCNSPRAELKESALNIFCSFPGVFGNQ 134 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 328 DVVSELARXHIDDDGNN--QWPEFLQXMFNCASAQDPN 435 D+++++A +D DGN +PEFLQ M DP+ Sbjct: 252 DMMNQIAFLFVDSDGNGAIDFPEFLQLMTKNLQDADPD 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,128,683 Number of Sequences: 59808 Number of extensions: 239559 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -