BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060532.seq (678 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 45 2e-06 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.2 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.2 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 24 3.8 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 24 5.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 45.2 bits (102), Expect = 2e-06 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 502 KELVGVAQTGSGKTLAYILPAIVH-INNQPPIR-RGDGPIALVLAPTRELA 648 ++L+ AQTGSGKT A++LP I H ++ + + R P +++APTRELA Sbjct: 212 RDLMACAQTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELA 262 Score = 38.7 bits (86), Expect = 2e-04 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = +2 Query: 350 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA 517 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++ +A Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMA 216 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.2 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -2 Query: 152 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 12 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -1 Query: 225 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 130 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 499 WKELVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDG 609 +K L AQ + ++ I A+V + Q +RR DG Sbjct: 456 YKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +3 Query: 225 QNMRRPDWDSFHSNLSTKTFMIHILQFSKDHHMKSKSIEINTR 353 QN+ RP+ L+T F +++ Q + H++ + I +R Sbjct: 94 QNISRPNLGELFQKLTTGFFSLNLFQIGQ--HVRGVLVSIKSR 134 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 302 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 394 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,139 Number of Sequences: 2352 Number of extensions: 14711 Number of successful extensions: 28 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -