BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060531.seq (678 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 5.1 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 5.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 5.1 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 6.7 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 6.7 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 8.9 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 324 CKPAPDDSVLTQALLKRHTELCPSPTD 404 CK APD + +T+ L+ P+PTD Sbjct: 611 CK-APDQAAVTRPLMAADLGAGPAPTD 636 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 5.1 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 300 LAEPAFPRCKPAPDDSVLTQALLKRHTELCPSPTDQAAVLSLVTKLQTVL 449 +AEP PAP+ +L + + + C A +L +T + +L Sbjct: 103 IAEPKAASATPAPELELLRATIQRLEEQNCAMKEQNAKLLEQITGMCQLL 152 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 5.1 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 3 HEMI*TIETAESVRLIQFEHYISSCVTIIKEKLEKTQLLCH 125 H ++ TI+TA++ +H I I EK+++ + CH Sbjct: 630 HIVVETIDTAKACIEFLKQHDIGRASFIALEKIQQYERNCH 670 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/45 (22%), Positives = 20/45 (44%) Frame = +2 Query: 497 RSAAVGSYKKGTMMAGKNVADIVVIMKTLPTKEAVEGLSNKVNRG 631 R +G + G M + + ++ LP V+G +++N G Sbjct: 4 RGLLMGRLRLGRRMVPLGLLGVTALLLILPPSALVQGRHHELNNG 48 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/45 (22%), Positives = 20/45 (44%) Frame = +2 Query: 497 RSAAVGSYKKGTMMAGKNVADIVVIMKTLPTKEAVEGLSNKVNRG 631 R +G + G M + + ++ LP V+G +++N G Sbjct: 4 RGLLMGRLRLGRRMVPLGLLGVTALLLILPPSALVQGRHHELNNG 48 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 360 ALLKRHTELCPSPTDQAAVLSLVTKLQTV 446 A+LK+ T P D ++ V K QT+ Sbjct: 510 AMLKKGTNRVTGPLDSDVLIEYVRKRQTI 538 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,141 Number of Sequences: 2352 Number of extensions: 13553 Number of successful extensions: 33 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -