BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060529.seq (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 0.42 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 3.0 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.4 bits (53), Expect = 0.42 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +2 Query: 266 DSEQWVEKESSIVQKETREDWMAMTGLLKTYSKQDIKPPRDVKKKNGIDSYNPSTS 433 DS+ E+ S ++ + ++ A G + +Q K P +VKK++ D P+TS Sbjct: 40 DSDNDEEERPSFKSRKPK-NYSAPIGFVAGGVQQAGKKPENVKKEDESDEEKPTTS 94 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 484 DTRKFSESRPFLKPSEEDDYYTL 552 D + S + ++KPS E DY+++ Sbjct: 146 DELRSSSAFSYIKPSSERDYFSV 168 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,231 Number of Sequences: 336 Number of extensions: 2482 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -