BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060528.seq (524 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 5.2 SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces po... 25 9.1 >SPAC7D4.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 551 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 503 VSPEXTIX*MPXRRVFRLPPGIRNWVE 423 VS + T P + + LPPGIRN V+ Sbjct: 385 VSLDQTSHPFPHQNTYILPPGIRNSVD 411 >SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 24.6 bits (51), Expect = 9.1 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +3 Query: 24 FLKMLGAISRVGSGILAVKSVAEKSLSECGKIVAVNAVNKRDY 152 F+K++ ++ G+G+LA+ VA+ ++ N + KRDY Sbjct: 11 FIKLVSSLQYTGNGVLALDFVAKTFPNQ------ENQLEKRDY 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,919,782 Number of Sequences: 5004 Number of extensions: 33751 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 214353836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -