BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060528.seq (524 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z19157-4|CAA79570.1| 1474|Caenorhabditis elegans Hypothetical pr... 27 6.2 AF003134-6|AAB54146.3| 827|Caenorhabditis elegans Hypothetical ... 27 8.2 >Z19157-4|CAA79570.1| 1474|Caenorhabditis elegans Hypothetical protein ZC84.6 protein. Length = 1474 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -2 Query: 493 NXQLXEC--RTEGFSGSHREYEIGLKPRSSSXRVCPTE 386 N L C R G SH Y + L P S R CPT+ Sbjct: 614 NGALQSCSERDGGCPSSHECYGVSLGPDMMSYRCCPTK 651 >AF003134-6|AAB54146.3| 827|Caenorhabditis elegans Hypothetical protein ZC581.9 protein. Length = 827 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 146 PLVNGIDCNDFSTF 105 PLVNG+ C D STF Sbjct: 594 PLVNGLACKDLSTF 607 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,778,791 Number of Sequences: 27780 Number of extensions: 198647 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1028310386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -