BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060527.seq (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 5.4 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 7.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 561 KSSICSLLMPKEERLGCLAELVWAKL 638 + S+ +LL E + C++E VW+KL Sbjct: 97 QQSVTALLDTGSE-VSCISEEVWSKL 121 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -3 Query: 382 ESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDRFCTSRHL 248 E++T CP K +V V++ + W T+ + D T + Sbjct: 122 ENTTNCPEQKNTVTVTFTVQSDDTTLNWGTNESYNLDLTTTGNQI 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,399 Number of Sequences: 336 Number of extensions: 3821 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -