BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060525.seq (683 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 37 0.53 UniRef50_A2DIP7 Cluster: Putative uncharacterized protein; n=1; ... 34 3.7 UniRef50_Q6C0Q5 Cluster: Yarrowia lipolytica chromosome F of str... 34 3.7 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 36.7 bits (81), Expect = 0.53 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 585 AERWYLPARTYKRSYHQ 535 AE WYLPART+KRSYH+ Sbjct: 569 AEWWYLPARTHKRSYHR 585 >UniRef50_A2DIP7 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 251 Score = 33.9 bits (74), Expect = 3.7 Identities = 20/63 (31%), Positives = 29/63 (46%) Frame = -1 Query: 662 SKSQYRYNGYPILQTETHYCFTAENRQSGGTYPRGLTRGPTTSNYTNYNFCGSIFITRCY 483 +K+ + P TET++ A N GG RG G + N T+ G+ FI+ Sbjct: 31 NKNVFEERSDPSYLTETNHGGNAVNGSGGGAGYRGGKGGENSDNITSIGISGTSFISPSS 90 Query: 482 SFT 474 SFT Sbjct: 91 SFT 93 >UniRef50_Q6C0Q5 Cluster: Yarrowia lipolytica chromosome F of strain CLIB122 of Yarrowia lipolytica; n=1; Yarrowia lipolytica|Rep: Yarrowia lipolytica chromosome F of strain CLIB122 of Yarrowia lipolytica - Yarrowia lipolytica (Candida lipolytica) Length = 137 Score = 33.9 bits (74), Expect = 3.7 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = -1 Query: 158 CHSLDTVHKPPAYIFLCSLRRKFRVSNGPVSATS 57 CH LDT PA LC + R VS GP ATS Sbjct: 8 CHILDTTRGRPAENVLCQIYRIGNVSGGPQRATS 41 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,938,081 Number of Sequences: 1657284 Number of extensions: 11806388 Number of successful extensions: 27688 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27685 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -