BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060525.seq (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 22 5.4 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 7.1 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.1 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.8 bits (44), Expect = 5.4 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 677 P*DVS-SKSQYRYNGYPILQTETHYCFTAENRQSGGTYPR 561 P D+S S+ + + P+L YC +R S G PR Sbjct: 171 PVDLSKSEPEKKTESQPMLWPAWVYCTRYSDRPSSGRSPR 210 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 110 CSLRRKFRVSNGPVSATSTLSSESG 36 C + R+ RVS+G VS E+G Sbjct: 74 CVISRQLRVSHGCVSKILNRYQETG 98 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 7.1 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -2 Query: 49 HRSQDFRYYCTEHP 8 HR+ D ++C+ HP Sbjct: 339 HRTVDDYFFCSPHP 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,416 Number of Sequences: 336 Number of extensions: 2995 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -