BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060523.seq (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 24 3.9 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 24 3.9 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 24 5.1 AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. 24 5.1 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = -1 Query: 606 NYCXNVIMRGLFRVE*NLRSICKHQFN*AVAKEFQQTG 493 N ++ +G R N+RS + + + K++++TG Sbjct: 151 NAASGMVRKGPIRAPANIRSTVRWDYQPDICKDYKETG 188 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = -1 Query: 606 NYCXNVIMRGLFRVE*NLRSICKHQFN*AVAKEFQQTG 493 N ++ +G R N+RS + + + K++++TG Sbjct: 151 NAASGMVRKGPIRAPANIRSTVRWDYQPDICKDYKETG 188 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 632 RSSCKLFTIIIVPT*SCEVCLELNKICGVYAST 534 +S+CKLFT +V + +C++ + G Y ++ Sbjct: 39 QSTCKLFTADVVSSITCKMYCVIKGKTGGYCNS 71 >AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. Length = 80 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 632 RSSCKLFTIIIVPT*SCEVCLELNKICGVYAST 534 +S+CKLFT +V + +C++ + G Y ++ Sbjct: 26 QSTCKLFTADVVSSITCKMYCVIKGKTGGYCNS 58 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,802 Number of Sequences: 2352 Number of extensions: 13207 Number of successful extensions: 51 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -