BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060523.seq (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 4.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 8.3 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.3 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.3 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 144 ENVRGEAVTVNSKRYVGMLRDLLGLELPKTCWYKFVD 34 +N+ G ++ SK + +L G +P WYKF++ Sbjct: 217 DNING--LSTESKADLPLLCPAQGFPVPVHRWYKFIE 251 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 637 LFPSKVTHGY 666 L+PS+ THGY Sbjct: 794 LYPSQTTHGY 803 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 88 QHTNISFGINSYSFTANIFKEI*SDHNSC*YYHI 189 +H IS N+Y++ N +K++ ++ YY+I Sbjct: 78 EHKIISSLSNNYNYNNNNYKKLYCNNYKKLYYNI 111 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 88 QHTNISFGINSYSFTANIFKEI*SDHNSC*YYHI 189 +H IS N+Y++ N +K++ ++ YY+I Sbjct: 78 EHKIISSLSNNYNYNNNNYKKLYCNNYKKLYYNI 111 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 535 VLAYTPQILFNSKQTSHDYVGTI 603 VL TP+ + HD++GT+ Sbjct: 89 VLGATPRDFLQNLDALHDHLGTL 111 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 535 VLAYTPQILFNSKQTSHDYVGTI 603 VL TP+ + HD++GT+ Sbjct: 89 VLGATPRDFLQNLDALHDHLGTL 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,383 Number of Sequences: 438 Number of extensions: 3635 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -