BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060522.seq (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8111| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 118 5e-27 SB_25097| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_57454| Best HMM Match : DUF924 (HMM E-Value=1) 71 7e-13 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 68 9e-12 SB_25096| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) 40 0.002 SB_49248| Best HMM Match : Cpn60_TCP1 (HMM E-Value=1.6) 38 0.006 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 36 0.043 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 32 0.53 SB_56262| Best HMM Match : Cpn60_TCP1 (HMM E-Value=6.6e-15) 31 0.70 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 31 0.70 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 31 1.2 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 30 1.6 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 29 3.7 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 29 3.7 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 28 6.5 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 28 8.6 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 28 8.6 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 28 8.6 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_8111| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 531 Score = 118 bits (284), Expect = 5e-27 Identities = 71/151 (47%), Positives = 94/151 (62%) Frame = +1 Query: 256 EVTNDGATILKSIGVDNPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQKL 435 +VTNDGATILKSIG+DNPAAKILV++SKVQD+EVGDGTTSVTV KL+ K+ Sbjct: 59 QVTNDGATILKSIGIDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKI 118 Query: 436 HPQTIIAGWRIASDAAKQALAEASLIIRRT*MRLH*EWI*KTSHGPH*AQRSFSNHKXHF 615 HPQTI+AGWR + AA++AL EA+ + + E + + + + H+ HF Sbjct: 119 HPQTIVAGWRKSVKAAEKAL-EAAAVDHSSDPEKFREDLMNIARTTL-SSKILVQHRDHF 176 Query: 616 TKLAV*WQFCV*KGSXNLKSYPNYPKYLGGL 708 KLAV + KGS +L + K GG+ Sbjct: 177 AKLAVDAVLRL-KGSGDLNAIQIIKKLGGGM 206 Score = 72.5 bits (170), Expect = 3e-13 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = +2 Query: 80 VSLNPIRILKNXXXXXXXXXXRMSSFIGAIAIGDLVKSTLGPKGMDKILVSCGRN 244 VSLNP+ IL R+SSF+GAIAIGDLVKSTLGPKGMDKIL S G+N Sbjct: 1 VSLNPVSILNQGAEEERAETARLSSFVGAIAIGDLVKSTLGPKGMDKILQSFGQN 55 Score = 34.3 bits (75), Expect = 0.099 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +3 Query: 507 LDHQKNLNEASLRVDLENIARTTLSSKILFKSQGAFHKIS 626 +DH + + R DL NIARTTLSSKIL + + F K++ Sbjct: 143 VDHSSDPEK--FREDLMNIARTTLSSKILVQHRDHFAKLA 180 >SB_25097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/73 (47%), Positives = 49/73 (67%) Frame = +1 Query: 259 VTNDGATILKSIGVDNPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQKLH 438 +TNDG IL+ I V +PAAK ++++S+ QDEEVGDGTTSV + +EQ++H Sbjct: 1 MTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMH 60 Query: 439 PQTIIAGWRIASD 477 P IIA +R+A D Sbjct: 61 PTQIIAAYRLAMD 73 >SB_57454| Best HMM Match : DUF924 (HMM E-Value=1) Length = 144 Score = 71.3 bits (167), Expect = 7e-13 Identities = 48/126 (38%), Positives = 69/126 (54%) Frame = +1 Query: 331 MSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQKLHPQTIIAGWRIASDAAKQALAEASL 510 +SKVQD+EVGDGTTSVTV KL+ K+HPQTI+AGWR + AA++AL EA+ Sbjct: 2 LSKVQDDEVGDGTTSVTVLASELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKAL-EAAA 60 Query: 511 IIRRT*MRLH*EWI*KTSHGPH*AQRSFSNHKXHFTKLAV*WQFCV*KGSXNLKSYPNYP 690 + + + + + + + H+ HF KLAV + KGS +L + Sbjct: 61 VDHSSDPEKFRDDLMNIARTTL-SSKILVQHRDHFAKLAVDAVLRL-KGSGDLNAIQIIK 118 Query: 691 KYLGGL 708 K GG+ Sbjct: 119 KLGGGM 124 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +3 Query: 507 LDHQKNLNEASLRVDLENIARTTLSSKILFKSQGAFHKIS 626 +DH + + R DL NIARTTLSSKIL + + F K++ Sbjct: 61 VDHSSDPEK--FRDDLMNIARTTLSSKILVQHRDHFAKLA 98 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 67.7 bits (158), Expect = 9e-12 Identities = 33/75 (44%), Positives = 47/75 (62%) Frame = +1 Query: 259 VTNDGATILKSIGVDNPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQKLH 438 VTNDGATIL + VD+ AK++V++SK QD E+GDGTT V V +L++ +H Sbjct: 68 VTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIH 127 Query: 439 PQTIIAGWRIASDAA 483 P I G+ +A+ A Sbjct: 128 PIRIADGYELAAKIA 142 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 143 RMSSFIGAIAIGDLVKSTLGPKGMDKILVS 232 + S + A A+ ++K++LGPKGMDK++VS Sbjct: 32 KQSHILAARAVASILKTSLGPKGMDKMMVS 61 >SB_25096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/76 (42%), Positives = 44/76 (57%) Frame = +1 Query: 250 SGEVTNDGATILKSIGVDNPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQ 429 SG G I V +PAAK ++++S+ QDEEVGDGTTSV + +EQ Sbjct: 195 SGRKVQLGNVQAAKIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQ 254 Query: 430 KLHPQTIIAGWRIASD 477 ++HP IIA +R+A D Sbjct: 255 QMHPTQIIAAYRLAMD 270 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/71 (25%), Positives = 34/71 (47%) Frame = +1 Query: 298 VDNPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQKLHPQTIIAGWRIASD 477 + +P A ++ ++ QD+ GDGTTS + + + LHP+ + G+ +A Sbjct: 171 IQHPTASLIARVATAQDDITGDGTTSNVMIIGELLKQADLYVSEGLHPRLVTEGFEVAKK 230 Query: 478 AAKQALAEASL 510 A + L E + Sbjct: 231 KALEVLEEVKV 241 >SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) Length = 724 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +1 Query: 259 VTNDGATILKSIGVDNPAAKILVDMSKVQDEE 354 ++NDGATI+ + + +PAAK LVD++K QD E Sbjct: 693 ISNDGATIINLLDIVHPAAKTLVDIAKSQDAE 724 Score = 32.3 bits (70), Expect = 0.40 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +2 Query: 173 IGDLVKSTLGPKGMDKILV 229 I D V++TLGP+GMDK++V Sbjct: 667 IADAVRTTLGPRGMDKLIV 685 >SB_49248| Best HMM Match : Cpn60_TCP1 (HMM E-Value=1.6) Length = 278 Score = 38.3 bits (85), Expect = 0.006 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Frame = +1 Query: 238 EELWSG-EVTNDGATILKSIGV----DNPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXX 402 E+ + G ++T DG T+ K+I + N A+++ D++ +EE GDGTT+ TV Sbjct: 97 EQSFGGPKITKDGVTVAKAIELKDKYQNIGARLVQDVANNTNEEAGDGTTTATVLARSIA 156 Query: 403 XXXXKLIEQKLHPQTI 450 + + +PQ + Sbjct: 157 TEGFLHVSKGANPQEV 172 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 35.5 bits (78), Expect = 0.043 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +2 Query: 143 RMSSFIGAIAIGDLVKSTLGPKGMDKIL 226 RM++ A A+ D ++++LGPKGMDK++ Sbjct: 26 RMTNITAAKAVADAIRTSLGPKGMDKMI 53 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 F DT++ L+ L NSCSPGDPL Sbjct: 4 FTDTLISANILHLYDLALTTSNSCSPGDPL 33 >SB_56262| Best HMM Match : Cpn60_TCP1 (HMM E-Value=6.6e-15) Length = 563 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +1 Query: 211 NG*DLSFLREELWSGEVTNDGATILKSIGVDNPAAKILVDMSKVQDEEVGDGTT 372 NG D+ LR + +TN G+ IL+S+ + NP +++V+ ++ G G + Sbjct: 23 NGLDV-MLRSSSGNILITNSGSMILESLTMGNPTERMIVEAARSLSGRTGSGAS 75 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 66 GPN*LFFFTLLVPNSCSPGDPL 1 GP L T+L NSCSPGDPL Sbjct: 8 GPTVLVPLTILGSNSCSPGDPL 29 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 31.5 bits (68), Expect = 0.70 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 60 N*LFFFTLLVPNSCSPGDPL 1 N LF L+ NSCSPGDPL Sbjct: 137 NLLFSINLITSNSCSPGDPL 156 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.1 bits (67), Expect = 0.92 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 F +LV NSCSPGDPL Sbjct: 1 FMCMLVSNSCSPGDPL 16 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 58 LIIFLYASRAEFLQPGGST 2 L+I +AS EFLQPGGST Sbjct: 45 LVILAFASLIEFLQPGGST 63 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 F DT++ L+++T NSCSPGDPL Sbjct: 4 FTDTLISANIVRLYYYTF-GSNSCSPGDPL 32 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 +F +L NSCSPGDPL Sbjct: 7 YFIMLASNSCSPGDPL 22 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 66 GPN*LFFFTLLVPNSCSPGDPL 1 GP+ F L+ NSCSPGDPL Sbjct: 881 GPSLSHPFPLVTSNSCSPGDPL 902 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 54 LFFFTLLVPNSCSPGDPL 1 +F TL V NSCSPGDPL Sbjct: 7 VFRVTLEVSNSCSPGDPL 24 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 LLV NSCSPGDPL Sbjct: 16 LLVSNSCSPGDPL 28 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 F L V NSCSPGDPL Sbjct: 36 FVLRVSNSCSPGDPL 50 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -3 Query: 75 LDEGPN*LFFFTLLVPNSCSPGDPL 1 L + PN LF T NSCSPGDPL Sbjct: 50 LSKLPNNLFIIT--TSNSCSPGDPL 72 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 54 LFFFTLLVPNSCSPGDPL 1 L+ F L+ NSCSPGDPL Sbjct: 34 LWTFKHLISNSCSPGDPL 51 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 51 FFFTLLVPNSCSPGDPL 1 F+ +V NSCSPGDPL Sbjct: 6 FYLIPMVSNSCSPGDPL 22 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 F L+ NSCSPGDPL Sbjct: 67 FPCLISNSCSPGDPL 81 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 102 IRIGFNDTILDEGPN*LFFF-TLLVPNSCSPGDPL 1 I++GF + + F +L++ NSCSPGDPL Sbjct: 3 IKVGFTCALPQNRLDLTFTLGSLIISNSCSPGDPL 37 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 F DT++ N L + + NSCSPGDPL Sbjct: 4 FTDTLISA--NILSYLPINESNSCSPGDPL 31 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 3 VDPPGCRNSAREA 41 VDPPGCRNS EA Sbjct: 16 VDPPGCRNSIHEA 28 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 +LV NSCSPGDPL Sbjct: 8 ILVSNSCSPGDPL 20 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 FT + NSCSPGDPL Sbjct: 7 FTCALSNSCSPGDPL 21 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 3 VDPPGCRNSAREA*RKIIN*VLHPKW 80 VDPPGCRNS ++ K ++H K+ Sbjct: 16 VDPPGCRNSIKDKGEKESMEIVHVKF 41 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 +LV NSCSPGDPL Sbjct: 1 MLVSNSCSPGDPL 13 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 +LV NSCSPGDPL Sbjct: 25 MLVSNSCSPGDPL 37 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 87 NDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 N T++ P+ L+ NSCSPGDPL Sbjct: 16 NKTLVPGPPSRSTVSISLISNSCSPGDPL 44 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 3 VDPPGCRNSAREA*RK 50 VDPPGCRNS + A +K Sbjct: 16 VDPPGCRNSMKPAAKK 31 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 F DT++ T + NSCSPGDPL Sbjct: 4 FTDTLISANIGCFQSQTRVTSNSCSPGDPL 33 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 LFFFTLLVPNSCSPGDPL 1 L + +V NSCSPGDPL Sbjct: 3468 LIYVARVVSNSCSPGDPL 3485 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 87 NDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 N T++ P+ L+ NSCSPGDPL Sbjct: 16 NKTLVPGPPSRSTVSISLISNSCSPGDPL 44 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 55 IIFLYASRAEFLQPGGST 2 ++ LY + EFLQPGGST Sbjct: 30 VVILYITIIEFLQPGGST 47 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 54 LFFFTLLVPNSCSPGDPL 1 L+ + L+ NSCSPGDPL Sbjct: 48 LYTYIPLLSNSCSPGDPL 65 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 78 ILDEGPN*LFFFTLLVPNSCSPGDPL 1 IL + L ++ + NSCSPGDPL Sbjct: 20 ILFKATTSLVYYRSITSNSCSPGDPL 45 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 87 NDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 N T++ P+ L+ NSCSPGDPL Sbjct: 16 NKTLVPGPPSRSTVSISLISNSCSPGDPL 44 >SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 FLYASRAEFLQPGGST 2 F Y R EFLQPGGST Sbjct: 19 FRYIHRIEFLQPGGST 34 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 42 TLLVPNSCSPGDPL 1 T+ V NSCSPGDPL Sbjct: 7 TVTVSNSCSPGDPL 20 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 42 TLLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 15 SFLISNSCSPGDPL 28 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 L V NSCSPGDPL Sbjct: 8 LFVSNSCSPGDPL 20 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 F L NSCSPGDPL Sbjct: 2 FALSASNSCSPGDPL 16 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 42 TLLVPNSCSPGDPL 1 T L NSCSPGDPL Sbjct: 13 TALTSNSCSPGDPL 26 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 F L+ NSCSPGDPL Sbjct: 34 FLDLISNSCSPGDPL 48 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 LL NSCSPGDPL Sbjct: 77 LLTSNSCSPGDPL 89 >SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 58 LIIFLYASRAEFLQPGGST 2 LII L+ EFLQPGGST Sbjct: 3 LIIKLFGHDIEFLQPGGST 21 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 LL NSCSPGDPL Sbjct: 4 LLASNSCSPGDPL 16 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 LFFFTLLVPNSCSPGDPL 1 L+ L+ NSCSPGDPL Sbjct: 2 LYVRIYLISNSCSPGDPL 19 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 58 LIIFLYASRAEFLQPGGST 2 LII L + EFLQPGGST Sbjct: 63 LIILLESLHIEFLQPGGST 81 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 ++ ++ NSCSPGDPL Sbjct: 6 YYKVITSNSCSPGDPL 21 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 LL NSCSPGDPL Sbjct: 87 LLTSNSCSPGDPL 99 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 42 TLLVPNSCSPGDPL 1 T ++ NSCSPGDPL Sbjct: 102 TFILSNSCSPGDPL 115 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 F L+ NSCSPGDPL Sbjct: 17 FPLFLISNSCSPGDPL 32 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -3 Query: 96 IGFNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 +GF D ++ L +F L NSCSPGDPL Sbjct: 16 LGFPDHLMFWAACCLAYFGFL-SNSCSPGDPL 46 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 F+T + NSCSPGDPL Sbjct: 19 FWTDRLSNSCSPGDPL 34 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 FT + NSCSPGDPL Sbjct: 4 FTDTLSNSCSPGDPL 18 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 F ++ NSCSPGDPL Sbjct: 8 FWIVTSNSCSPGDPL 22 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 42 TLLVPNSCSPGDPL 1 T+ V NSCSPGDPL Sbjct: 211 TVNVSNSCSPGDPL 224 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 43 YASRAEFLQPGGST 2 Y +R EFLQPGGST Sbjct: 225 YENRIEFLQPGGST 238 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLL-VPNSCSPGDPL 1 F DT++ + + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIGHVVYINIIRQSNSCSPGDPL 34 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 +++ NSCSPGDPL Sbjct: 13 IIISNSCSPGDPL 25 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 L V NSCSPGDPL Sbjct: 2 LYVSNSCSPGDPL 14 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -3 Query: 93 GFNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 GF+ I EG F L NSCSPGDPL Sbjct: 52 GFSGIIFMEGR-----FPKLSSNSCSPGDPL 77 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLLVPN---SCSPGDPL 1 F DT++ + +F + PN SCSPGDPL Sbjct: 4 FTDTLISANISDIFTTFVFDPNTSNSCSPGDPL 36 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 24 LISNSCSPGDPL 35 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 LLVPNSCSPGDPL 1 +L+ NSCSPGDPL Sbjct: 5 ILLSNSCSPGDPL 17 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 F L V NSCSPGDPL Sbjct: 13 FNHLKVSNSCSPGDPL 28 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 51 FFFTLLVPNSCSPGDPL 1 F ++ + NSCSPGDPL Sbjct: 61 FCYSFIGSNSCSPGDPL 77 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 + L + NSCSPGDPL Sbjct: 167 YELFLSNSCSPGDPL 181 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 90 FNDTILDEGPN*LFFFTLLVPNSCSPGDPL 1 F DT++ N L+ NSCSPGDPL Sbjct: 4 FTDTLISANIN--TQSKLVASNSCSPGDPL 31 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 34 LISNSCSPGDPL 45 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/18 (83%), Positives = 15/18 (83%), Gaps = 2/18 (11%) Frame = -3 Query: 48 FFTL-LVP-NSCSPGDPL 1 F TL LVP NSCSPGDPL Sbjct: 22 FTTLPLVPSNSCSPGDPL 39 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 42 TLLVPNSCSPGDPL 1 T + NSCSPGDPL Sbjct: 4 TYFISNSCSPGDPL 17 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 16 LISNSCSPGDPL 27 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 45 FTLLVPNSCSPGDPL 1 F ++ NSCSPGDPL Sbjct: 9 FYFILSNSCSPGDPL 23 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -3 Query: 51 FFFTLLVPNSCSPGDPL 1 +++ ++ NSCSPGDPL Sbjct: 421 YWYRMVSSNSCSPGDPL 437 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 31 LISNSCSPGDPL 42 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 48 FFTLLVPNSCSPGDPL 1 +F V NSCSPGDPL Sbjct: 5 YFINSVSNSCSPGDPL 20 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,210,354 Number of Sequences: 59808 Number of extensions: 339071 Number of successful extensions: 2098 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 2058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2098 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -