BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060522.seq (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 25 0.53 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 5.0 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 8.7 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 25.4 bits (53), Expect = 0.53 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +1 Query: 136 SCSDV--QFHRCYCHRRFGKE 192 SCS QF CYC RFG++ Sbjct: 418 SCSSFFQQFFHCYCPVRFGRK 438 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 359 EMAPHLLLFWLLNYF 403 E+A LLL W+L YF Sbjct: 175 ELAGTLLLVWILCYF 189 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 546 LLMKPHLSSSDDQASFCKSLFGCIRSN-SPTSNDCL 442 +LM +L+S FC++ GC N +P D + Sbjct: 148 VLMGANLASEVANEMFCETTIGCKDKNMAPILKDLM 183 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,273 Number of Sequences: 438 Number of extensions: 3274 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -