BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060521.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 3.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.9 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 3.9 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +1 Query: 109 SCSDV--QFHRCYCHRRFGKE 165 SCS QF CYC +FG++ Sbjct: 401 SCSSFFQQFFHCYCPVKFGRK 421 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.9 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 259 KSIGVD-NPAAKILVDMSKVQDEEVGDGTTSVTVXXXXXXXXXXKLIEQKLH 411 +++ VD NP D + + D+E D ++T+ K +++KLH Sbjct: 693 EAVPVDLNPTIYYGPDYTVILDKEFEDDRVAITIRNLLGGTDGPKAMKEKLH 744 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,331 Number of Sequences: 2352 Number of extensions: 9479 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -