BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060519.seq (680 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0387 - 20834510-20834978,20836866-20837329,20837458-20837634 30 2.0 02_01_0783 + 5835517-5835861,5835989-5836060,5836140-5836220,583... 28 6.0 >05_04_0387 - 20834510-20834978,20836866-20837329,20837458-20837634 Length = 369 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 363 KQDIKPPRDVKKXNGIDSYNPSTSSRELNPYWKDG 467 K+++K RDV NG+ S T + + P WK G Sbjct: 200 KKEVKYTRDVVAKNGLVSKKEETKTIRVKPGWKKG 234 >02_01_0783 + 5835517-5835861,5835989-5836060,5836140-5836220, 5836293-5836490,5836576-5836647,5836803-5836889, 5836986-5837084,5837191-5837274,5837351-5837437, 5837578-5837649,5837912-5838025,5838127-5838214, 5838293-5838388,5838507-5838694 Length = 560 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 378 PPRDVKKXNGIDSYNPSTSSRELNPYWKDGGSXLP 482 P D K N I P T + EL P W+DG + P Sbjct: 333 PNFDQMKGNKICKQIPWTENEELFPAWRDGRTGYP 367 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,146,673 Number of Sequences: 37544 Number of extensions: 175426 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -