BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060519.seq (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) 29 4.6 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 28 6.1 >SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) Length = 3015 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 287 FQPIALNQNLKTX*VNNMCFFFTLKLFRLMRFILVLFLFHFEHD 156 FQ + Q + ++ FF T+KL RL+RF + +F F D Sbjct: 2442 FQKAVMIQEAENIALSFTVFFATMKLLRLIRFNPHIIIFSFSLD 2485 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/75 (25%), Positives = 31/75 (41%) Frame = +3 Query: 285 KKKVQYVXKETREDWMAMTGLLKTYSKQDIKPPRDVKKXNGIDSYNPSTSSRELNPYWKD 464 K K+ +E W + LL S Q + ++K NG Y P + N Y+ + Sbjct: 574 KNKIAQEHDNPKEAWKIINDLLGRSSDQ--RTVNEIK-INGASVYAPDEIAENFNQYFSN 630 Query: 465 GGSXLPQTPESFRKA 509 G L + +S K+ Sbjct: 631 IGQNLAASIDSLSKS 645 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,532,487 Number of Sequences: 59808 Number of extensions: 215945 Number of successful extensions: 518 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -