BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060519.seq (680 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061353-1|AAL28901.1| 687|Drosophila melanogaster LD28117p pro... 62 5e-10 AE014298-2173|AAF48473.2| 687|Drosophila melanogaster CG9213-PA... 62 5e-10 >AY061353-1|AAL28901.1| 687|Drosophila melanogaster LD28117p protein. Length = 687 Score = 62.5 bits (145), Expect = 5e-10 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +3 Query: 318 REDWMAMTGLL-KTYSKQDIKPPRDVKKXNGIDSYNPSTSSRELNPYWKDGGSXLP 482 R+DWM LL KT+S++ +P + +K ID+Y+P+ S RELNPYWK G+ LP Sbjct: 154 RDDWMTSESLLLKTFSRERKEPAKPNEKAQQIDAYDPAKSGRELNPYWKSNGTGLP 209 >AE014298-2173|AAF48473.2| 687|Drosophila melanogaster CG9213-PA protein. Length = 687 Score = 62.5 bits (145), Expect = 5e-10 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +3 Query: 318 REDWMAMTGLL-KTYSKQDIKPPRDVKKXNGIDSYNPSTSSRELNPYWKDGGSXLP 482 R+DWM LL KT+S++ +P + +K ID+Y+P+ S RELNPYWK G+ LP Sbjct: 154 RDDWMTSESLLLKTFSRERKEPAKPNEKAQQIDAYDPAKSGRELNPYWKSNGTGLP 209 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,685,547 Number of Sequences: 53049 Number of extensions: 307127 Number of successful extensions: 639 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2971922400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -