BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060518.seq (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam ... 30 1.6 At3g27720.1 68416.m03461 zinc finger protein-related contains Pf... 29 2.9 At2g44470.1 68415.m05529 glycosyl hydrolase family 1 protein con... 29 3.8 At2g28210.1 68415.m03425 carbonic anhydrase family protein simil... 29 3.8 >At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam profiles PF04677: Protein similar to CwfJ N terminus 1, PF04676: Protein similar to CwfJ N terminus 2 Length = 692 Score = 29.9 bits (64), Expect = 1.6 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 1/103 (0%) Frame = +3 Query: 171 ERXKAQE*IS*AERA*E*KKSTYY*LIKSSNSDSEQWVEKESSIVQKETXEDWMAMTGIL 350 +R + + ++ ER E K + KS + ++ E IV+K+ DWM L Sbjct: 30 DRRRKNKDVNRKERRGEGSKRDGKKIAKSGDGETVDDDLLEGDIVRKKMGLDWM-----L 84 Query: 351 KTYXKQDIKRPRDVXKKNGIDSYN-TSTSSRELNPXWKDGGSG 476 K D DV K + T + RELNP K+ G+G Sbjct: 85 PPTRKADPNPASDVEDKFEESAPEVTKVNPRELNPYLKENGTG 127 >At3g27720.1 68416.m03461 zinc finger protein-related contains Pfam:PF01485 IBR domain Length = 493 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 503 ESRDFXKPSEEDDYYTLCYRGHKSDYXHSKQ 595 E D PSE DD+ +C +SD HS++ Sbjct: 10 EEEDNCYPSEFDDHDQMCSNAEESDLQHSRE 40 >At2g44470.1 68415.m05529 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 451 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 357 YXKQDIKRPRDVXKKNGIDSYNTSTSSRE 443 Y K P K+NGID Y+ T SRE Sbjct: 399 YIKDKYNNPIVYVKENGIDHYDDGTKSRE 427 >At2g28210.1 68415.m03425 carbonic anhydrase family protein similar to storage protein (dioscorin) [Dioscorea cayenensis] GI:433463; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 217 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 441 ELNPXWKDGGSGLLQTP-ESFRKAEISSNHLKKMTTIHY 554 +L P WK G G +Q+P + K HLKK+T HY Sbjct: 26 KLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTR-HY 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,130,504 Number of Sequences: 28952 Number of extensions: 152932 Number of successful extensions: 419 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -