BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060517.seq (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 30 0.019 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 30 0.019 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 1.7 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.2 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.8 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 6.7 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.9 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 29.9 bits (64), Expect = 0.019 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +2 Query: 263 RQDQQRKSRTAPMGRMRKIHAVHPNLLTYTAKLFDTRSSF 382 RQ+ Q +++ P G ++ + +H NL+T + ++ D+ S F Sbjct: 202 RQNSQTRNQAVPTGTIKTLVQMHSNLVTTSEEVCDSFSIF 241 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 29.9 bits (64), Expect = 0.019 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +2 Query: 263 RQDQQRKSRTAPMGRMRKIHAVHPNLLTYTAKLFDTRSSF 382 RQ+ Q +++ P G ++ + +H NL+T + ++ D+ S F Sbjct: 202 RQNSQTRNQAVPTGTIKTLVQMHSNLVTTSEEVCDSFSIF 241 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 249 LKDVVLQGMELFI 211 LK+VVL G+ELFI Sbjct: 293 LKNVVLYGLELFI 305 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/49 (24%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -3 Query: 425 CLIRAAVPLSRPDRRTTTGYRRVWRYMSADWDG----LREFYASYPWGR 291 C + R +R Y ++W + A WD +R+F S+ G+ Sbjct: 75 CTEKQRTAAYRSIKRLKKEYPKIWEQLRAVWDPDDVFIRKFETSFESGK 123 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 182 RPPTGTSEEGINNSIPWSTTSLRRSH 259 RPP T S+P S +S RR H Sbjct: 212 RPPQETPVLASYKSVPMSFSSPRRRH 237 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 612 PLTSRVGLPTISPWPTASPSW*HSPPVSQIS 520 P S LP+ISP P W PP+ S Sbjct: 194 PSVSPASLPSISPSGGFLPKW--LPPLQGFS 222 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 Query: 413 HE*GSDQTIQAERRPPHC 466 H+ DQ + RPP C Sbjct: 545 HDLSPDQFCNGDNRPPDC 562 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,041 Number of Sequences: 336 Number of extensions: 4435 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -