BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060512.seq (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.0 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 22 6.2 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 6.2 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 6.2 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.2 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 491 PVWPVNCPHCCPVSMSHSAQVMSPELVRIWLSSRKRQQ 378 P+ P+ +C PV + + ++SP VR LSS + Q Sbjct: 786 PILPMIPVYCVPVPQVNDSTILSP--VREKLSSSQPMQ 821 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 343 TRARCPRASSGYKSSRC 293 TR RC R+ GY + C Sbjct: 106 TRVRCGRSLEGYPFNPC 122 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 6.2 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +1 Query: 235 GDDLRLRPS-GSYVACGGLD-NICSIYSLKTREGNVRVSRELPGHSGYLSCCRFLDDNQI 408 G D+RLRP+ G G+D I S ++ + ++ L + F + ++ Sbjct: 47 GYDIRLRPNFGGEPLLVGMDLTIASFDAISEVNMDYTITMYLNQYWKDERLA-FSQEEEV 105 Query: 409 LTSSGDMTCALWDIET 456 LT SGD +W +T Sbjct: 106 LTLSGDFAEKIWVPDT 121 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 343 TRARCPRASSGYKSSRC 293 TR RC R+ GY + C Sbjct: 122 TRVRCGRSLEGYPFNPC 138 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -2 Query: 482 PVNCPHCCPVSMSHSAQVMSPELVRIWLSSRKR 384 P P ++ H+ M+P+ + W+ R R Sbjct: 417 PKPFPRRATLAQLHNFTTMTPQEIAQWIDRRSR 449 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,626 Number of Sequences: 438 Number of extensions: 2993 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -