BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060509.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 26 1.3 AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse t... 25 2.9 AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse t... 25 2.9 AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse t... 25 2.9 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 2.9 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.8 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 155 KSVEIMISQPKNRVQAIKSKFENLGNENKPLLINTQPHS 271 +S E ++ PK +A+ + NL +++ L+NT P S Sbjct: 649 ESGEPVVENPKQIEEAVMNLITNLQPDSEDKLLNTMPAS 687 >AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 RNQIAPKRHGSCNGRSETAN 572 RN I+P +HG RS T N Sbjct: 28 RNYISPNQHGFVPNRSTTTN 47 >AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 RNQIAPKRHGSCNGRSETAN 572 RN I+P +HG RS T N Sbjct: 28 RNYISPNQHGFVPNRSTTTN 47 >AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 513 RNQIAPKRHGSCNGRSETAN 572 RN I+P +HG RS T N Sbjct: 28 RNYISPNQHGFVPNRSTTTN 47 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 226 RKREQTALDKHTTTQLCKQKNSGVNIEEKH 315 RKR + A++ T + CKQ+ S I+ +H Sbjct: 8 RKRTRQAVNCTATGRRCKQRKSPYTIDFEH 37 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 522 IAPKRHGSCNGRSETAN 572 I+PK+HG GRS + N Sbjct: 575 ISPKQHGFMPGRSTSTN 591 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,764 Number of Sequences: 2352 Number of extensions: 12879 Number of successful extensions: 48 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -