BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060506.seq (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7120| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 >SB_7120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 77.8 bits (183), Expect = 8e-15 Identities = 40/76 (52%), Positives = 46/76 (60%) Frame = +1 Query: 388 LKRXMXDYVKSGFINVDKXSKXQLXRSSFMDKTYFKSXKDCXLGTLDRKVXGCXXVCIDX 567 LKR + DY+ SGFIN+DK + + + K GTLD KV GC VCID Sbjct: 70 LKREIKDYISSGFINLDKPANPSSHEVVAWLRRILRVEKTGHSGTLDPKVTGCLIVCIDK 129 Query: 568 ATRLVKSQQNAGKEYV 615 ATRLVKSQQ AGKEYV Sbjct: 130 ATRLVKSQQGAGKEYV 145 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +3 Query: 321 KNFDRLNVRTNHYTPLPFGNXPFK 392 +N+D+LN+RT H+TPLP G P K Sbjct: 48 RNYDKLNIRTGHFTPLPNGCSPLK 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,835,850 Number of Sequences: 59808 Number of extensions: 229160 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -