BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060506.seq (686 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92803-7|CAB07244.1| 445|Caenorhabditis elegans Hypothetical pr... 74 1e-13 >Z92803-7|CAB07244.1| 445|Caenorhabditis elegans Hypothetical protein K01G5.5 protein. Length = 445 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/76 (48%), Positives = 43/76 (56%) Frame = +1 Query: 388 LKRXMXDYVKSGFINVDKXSKXQLXRSSFMDKTYFKSXKDCXLGTLDRKVXGCXXVCIDX 567 LKR + +Y+ SGF N+DK S K + K GTLD KV GC VCID Sbjct: 67 LKRDIKNYISSGFFNLDKPSNPSSHEVVSWIKRILRCEKTGHSGTLDPKVSGCLIVCIDR 126 Query: 568 ATRLVKSQQNAGKEYV 615 TRL KSQQ AGKEY+ Sbjct: 127 TTRLAKSQQGAGKEYI 142 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 258 FKIEPSEXVKKLDXAYWXLLLKNFDRLNVRTNHYTPLPFGNXPFK 392 F++ S KLD + W LLLKN+D+LNVRTNHYTP G P K Sbjct: 24 FQLPSSNETAKLDASQWPLLLKNYDKLNVRTNHYTPHVEGVSPLK 68 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,880,166 Number of Sequences: 27780 Number of extensions: 174398 Number of successful extensions: 310 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -