BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060503.seq (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.10c |arc2|arc34|ARP2/3 actin-organizing complex subunit ... 76 6e-15 >SPAC6F6.10c |arc2|arc34|ARP2/3 actin-organizing complex subunit Arc34|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 75.8 bits (178), Expect = 6e-15 Identities = 37/77 (48%), Positives = 48/77 (62%) Frame = +2 Query: 23 GDNISYVTFVLFPRHTCAAARDNTIDLLHMFRDYLHYHIKCSKVYVXSRMRAKAGDLLKV 202 GD+ +VTFVLF RH R++ I + +FR+ LH+HIK SK Y+ RMR + D KV Sbjct: 235 GDDFGFVTFVLFERHFTPQNREDCISHIQVFRNTLHFHIKASKAYMHQRMRKRVADFQKV 294 Query: 203 LNRARPHAAARXSERKT 253 LNRA+P ERKT Sbjct: 295 LNRAKPDVEL---ERKT 308 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,306,295 Number of Sequences: 5004 Number of extensions: 37831 Number of successful extensions: 107 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -