BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060503.seq (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37784| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 >SB_37784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 107 bits (256), Expect = 1e-23 Identities = 47/80 (58%), Positives = 62/80 (77%) Frame = +2 Query: 14 ARVGDNISYVTFVLFPRHTCAAARDNTIDLLHMFRDYLHYHIKCSKVYVXSRMRAKAGDL 193 A G+NI+Y+TFVL PRHT AR+ TI+L+H FR+YLHYHIKCSK Y+ +RMRA+ D Sbjct: 111 ASTGENIAYITFVLEPRHTNPKAREGTINLIHTFRNYLHYHIKCSKAYLHTRMRARTADF 170 Query: 194 LKVLNRARPHAAARXSERKT 253 +K+LNRARP + +E+KT Sbjct: 171 IKILNRARPE--PKTTEKKT 188 >SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3112 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 164 SXRTPWST*CGSAGSRGTCAAGRWCCRAPPRTC 66 S +TPW C ++ + G CAA C A RTC Sbjct: 107 SAQTPWGANCTNSTTEGFCAAS-MSCGAKNRTC 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,201,964 Number of Sequences: 59808 Number of extensions: 312817 Number of successful extensions: 893 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -