BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060503.seq (684 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060391-1|AAL25430.1| 301|Drosophila melanogaster LD29815p pro... 130 2e-30 AE014134-3239|AAF53892.2| 301|Drosophila melanogaster CG10954-P... 130 2e-30 BT029620-1|ABL75679.1| 127|Drosophila melanogaster IP17106p pro... 31 1.9 BT029556-1|ABL75616.1| 127|Drosophila melanogaster IP16806p pro... 31 1.9 >AY060391-1|AAL25430.1| 301|Drosophila melanogaster LD29815p protein. Length = 301 Score = 130 bits (314), Expect = 2e-30 Identities = 60/82 (73%), Positives = 67/82 (81%) Frame = +2 Query: 8 SDARVGDNISYVTFVLFPRHTCAAARDNTIDLLHMFRDYLHYHIKCSKVYVXSRMRAKAG 187 +DARVGDNI YVTFVLFPRHT RDNTI+L+HMFRDYLHYHIKCSK Y+ SRMRAK Sbjct: 212 TDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDYLHYHIKCSKAYIHSRMRAKTS 271 Query: 188 DLLKVLNRARPHAAARXSERKT 253 D LKVLNRARP + +E+KT Sbjct: 272 DFLKVLNRARPE--PKNTEKKT 291 >AE014134-3239|AAF53892.2| 301|Drosophila melanogaster CG10954-PA protein. Length = 301 Score = 130 bits (314), Expect = 2e-30 Identities = 60/82 (73%), Positives = 67/82 (81%) Frame = +2 Query: 8 SDARVGDNISYVTFVLFPRHTCAAARDNTIDLLHMFRDYLHYHIKCSKVYVXSRMRAKAG 187 +DARVGDNI YVTFVLFPRHT RDNTI+L+HMFRDYLHYHIKCSK Y+ SRMRAK Sbjct: 212 TDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDYLHYHIKCSKAYIHSRMRAKTS 271 Query: 188 DLLKVLNRARPHAAARXSERKT 253 D LKVLNRARP + +E+KT Sbjct: 272 DFLKVLNRARPE--PKNTEKKT 291 >BT029620-1|ABL75679.1| 127|Drosophila melanogaster IP17106p protein. Length = 127 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 137 CGSAGSRGTCAAGRWCCRAPPRTCAAGT 54 CG G G+C G CCR C G+ Sbjct: 22 CGGGGCCGSCCVGGSCCRGGTGGCCGGS 49 >BT029556-1|ABL75616.1| 127|Drosophila melanogaster IP16806p protein. Length = 127 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 137 CGSAGSRGTCAAGRWCCRAPPRTCAAGT 54 CG G G+C G CCR C G+ Sbjct: 22 CGGGGCCGSCCVGGSCCRGGTGGCCGGS 49 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,009,896 Number of Sequences: 53049 Number of extensions: 440034 Number of successful extensions: 1434 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1434 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2992560750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -