BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060500.seq (503 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 38 2e-04 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 29 0.12 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 27 0.36 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 1.1 AY748851-1|AAV28197.1| 98|Anopheles gambiae cytochrome P450 pr... 25 1.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 4.5 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 7.8 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 37.9 bits (84), Expect = 2e-04 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 7/47 (14%) Frame = +1 Query: 292 PIEMLVQALYDFTPQE-------AXELEFRRGDVITVTDRSDQHWWQ 411 P+E+ V+A +D+ P + + FR GD++ + + D HWWQ Sbjct: 563 PVEIFVRAQFDYDPLDDELIPCAQAGIAFRVGDILQIISKDDHHWWQ 609 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 28.7 bits (61), Expect = 0.12 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 313 ALYDFTPQEAXELEFRRGDVITVTDRSDQHWWQGXI 420 +L D +P + F GD + + ++ D +WW G + Sbjct: 98 SLDDDSPVHGSAVSFEVGDFLHIKEKYDNNWWIGRL 133 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 27.1 bits (57), Expect = 0.36 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 25 GRITRADAEKLLANKPEGGFLIRISESSPGDFSLS 129 G I ++ AEK LA G FL+R ++S G S++ Sbjct: 552 GFIHKSTAEKYLAKCVPGTFLLRFTDSVLGGISIA 586 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.4 bits (53), Expect = 1.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 202 VKFNSLNELAXLSSYRVCSR 261 ++FN + +A ++ YRVCS+ Sbjct: 3298 LQFNKASSMATINEYRVCSK 3317 >AY748851-1|AAV28197.1| 98|Anopheles gambiae cytochrome P450 protein. Length = 98 Score = 24.6 bits (51), Expect = 1.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 216 RIELDDPKEELARGVS*YFEVLDTVRTFD 130 R E+D+ +E LA G + +EVL ++ D Sbjct: 52 RAEIDEQRESLADGRTPTYEVLQKMKYLD 80 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 4.5 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 193 LWVVKFNSLNELAXLSSYRVC 255 ++ ++FN + +A ++ YRVC Sbjct: 3298 IFPLQFNKASSMATINEYRVC 3318 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 7.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -1 Query: 440 NNPRR*AXSPCHQCWSERSVTVMTSPRLN 354 NNP + + CH ER +V P N Sbjct: 1139 NNPLKGKLTNCHSSGCERPFSVQKIPNSN 1167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 454,875 Number of Sequences: 2352 Number of extensions: 7899 Number of successful extensions: 58 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -