BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060500.seq (503 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18060.1 68417.m02687 SH3 domain-containing protein 3 (SH3P3)... 34 0.047 At1g48970.1 68414.m05489 eukaryotic translation initiation facto... 29 1.8 At2g44350.2 68415.m05517 citrate synthase, mitochondrial, putati... 29 2.4 At2g44350.1 68415.m05516 citrate synthase, mitochondrial, putati... 29 2.4 At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain... 28 3.1 At5g21170.1 68418.m02530 5'-AMP-activated protein kinase beta-2 ... 28 4.1 At5g07920.1 68418.m00916 diacylglycerol kinase 1 (DGK1) identica... 27 5.4 At1g62530.1 68414.m07055 hypothetical protein 27 5.4 At3g60100.1 68416.m06711 citrate synthase, mitochondrial, putati... 27 7.2 At2g21610.1 68415.m02570 pectinesterase family protein contains ... 27 9.5 At2g18900.1 68415.m02205 transducin family protein / WD-40 repea... 27 9.5 >At4g18060.1 68417.m02687 SH3 domain-containing protein 3 (SH3P3) nearly identical to SH3 domain-containing protein 3 [Arabidopsis thaliana] GI:16974680; contains Pfam profile PF00018: SH3 domain Length = 351 Score = 34.3 bits (75), Expect = 0.047 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 304 LVQALYDFTPQEAXELEFRRGDVITVTDRSDQHWWQGXIAHRRGLFPAXYV 456 L + ++ F+ EL+ +GD I V S W +G + G FP Y+ Sbjct: 285 LAEVIHPFSAASEKELDLDKGDYIVVRKVSQTGWAEGECKGKAGWFPMAYI 335 >At1g48970.1 68414.m05489 eukaryotic translation initiation factor 2B family protein / eIF-2B family protein similar to guanine nucleotide exchange factor, eIF-2B, delta subunit [Mus musculus] GI:529428; contains Pfam profile PF01008: Initiation factor 2 subunit family Length = 756 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 37 RADAEKLLANKPEGGFLIRISESSPGDFSLSVKCPDGVQHFKVLRDASSKF 189 R+D+ KL A+ P GGF + ++ +P + + Q K + + S F Sbjct: 140 RSDSTKLSASLPNGGFDLTLAVRAPQESETKIATTSASQGKKKIAEVSETF 190 >At2g44350.2 68415.m05517 citrate synthase, mitochondrial, putative strong similarity to SP|P20115 Citrate synthase, mitochondrial precursor {Arabidopsis thaliana}; contains Pfam profile PF00285: Citrate synthase Length = 474 Score = 28.7 bits (61), Expect = 2.4 Identities = 25/71 (35%), Positives = 29/71 (40%) Frame = +1 Query: 250 VCSRLQALKLRDVVPIEMLVQALYDFTPQEAXELEFRRGDVITVTDRSDQHWWQGXIAHR 429 VC R ALK P+ LV LY+ P EL G V D H G + + Sbjct: 365 VCQREFALKHLPDDPLFQLVSKLYEVVPPVLTEL----GKVKNPWPNVDAH--SGVLLNH 418 Query: 430 RGLFPAXYVTV 462 GL A Y TV Sbjct: 419 YGLTEARYYTV 429 >At2g44350.1 68415.m05516 citrate synthase, mitochondrial, putative strong similarity to SP|P20115 Citrate synthase, mitochondrial precursor {Arabidopsis thaliana}; contains Pfam profile PF00285: Citrate synthase Length = 473 Score = 28.7 bits (61), Expect = 2.4 Identities = 25/71 (35%), Positives = 29/71 (40%) Frame = +1 Query: 250 VCSRLQALKLRDVVPIEMLVQALYDFTPQEAXELEFRRGDVITVTDRSDQHWWQGXIAHR 429 VC R ALK P+ LV LY+ P EL G V D H G + + Sbjct: 364 VCQREFALKHLPDDPLFQLVSKLYEVVPPVLTEL----GKVKNPWPNVDAH--SGVLLNH 417 Query: 430 RGLFPAXYVTV 462 GL A Y TV Sbjct: 418 YGLTEARYYTV 428 >At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein hypothetical proteins - Arabidopsis thaliana contains Pfam profile PF00564: PB1 domain Length = 476 Score = 28.3 bits (60), Expect = 3.1 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 9/65 (13%) Frame = -1 Query: 389 RSVTVMTSPRLNSNSXAS-------CGVKSYRACTNISMGTTSRSLSA*R--RLQTRYDD 237 +SV +M + R NS + S CG +S TN S G+TS S+S+ +++ +D Sbjct: 197 KSVEMMQTRRTNSGTSGSGDGNGGICGQESMMLETNSSFGSTSSSVSSSNLPPIKSSGED 256 Query: 236 NXASS 222 N A+S Sbjct: 257 NIANS 261 >At5g21170.1 68418.m02530 5'-AMP-activated protein kinase beta-2 subunit, putative similar to Swiss-Prot:Q9QZH4 5'-AMP-activated protein kinase, beta-2 subunit (AMPK beta-2 chain) [Rattus norvegicus] Length = 283 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 100 ESSPGDFSLSVKCPDGVQHFKVLRDASSKF 189 + S D S+ P G+ H+KV+ D SK+ Sbjct: 129 QKSGKDHSILFVLPSGIYHYKVIVDGESKY 158 >At5g07920.1 68418.m00916 diacylglycerol kinase 1 (DGK1) identical to diacylglycerol kinase 1 (Diglyceride kinase 1, DGK 1, DAG kinase 1) [Arabidopsis thaliana] SWISS-PROT:Q39017 Length = 728 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 236 YHRTASAVAFKHLNCATSSP*KCWC 310 +HR A H NC++S+P C C Sbjct: 115 FHRCTICGAAAHFNCSSSAPKDCKC 139 >At1g62530.1 68414.m07055 hypothetical protein Length = 282 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +1 Query: 262 LQALKLRDVVPIEMLV---QALYDFTPQEAXELEFRRG 366 L L++R+ VP E+ +A+YDF+ ++ ++ RRG Sbjct: 175 LHTLEIRETVPEELCCVSSKAIYDFSKKKEFGVKLRRG 212 >At3g60100.1 68416.m06711 citrate synthase, mitochondrial, putative strong similarity to SP|Q43175 Citrate synthase, mitochondrial precursor {Solanum tuberosum}; contains Pfam profile PF00285: Citrate synthase Length = 433 Score = 27.1 bits (57), Expect = 7.2 Identities = 24/71 (33%), Positives = 29/71 (40%) Frame = +1 Query: 250 VCSRLQALKLRDVVPIEMLVQALYDFTPQEAXELEFRRGDVITVTDRSDQHWWQGXIAHR 429 +C R ALK P+ LV LY+ P EL G V D H G + + Sbjct: 326 ICQREFALKHLPDDPLFQLVSKLYEVVPPILTEL----GKVKNPWPNVDAH--SGVLLNY 379 Query: 430 RGLFPAXYVTV 462 GL A Y TV Sbjct: 380 YGLTEARYYTV 390 >At2g21610.1 68415.m02570 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 352 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 85 LIRISESSPGDFSLSVKCPDGVQHFKVLRDASSKFFLWV 201 LIR+ +S GDFS K + ++ + S +F+WV Sbjct: 50 LIRVDQSGKGDFS---KIQEAIESIPPNLNNSQLYFIWV 85 >At2g18900.1 68415.m02205 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 804 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 291 PHRNVGAGSIRLHPTRGXRV 350 PHR+ G +I HPTR V Sbjct: 482 PHRDAGVSAIVFHPTRSMAV 501 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,520,101 Number of Sequences: 28952 Number of extensions: 171925 Number of successful extensions: 436 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -